Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48840-AT3G18350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF639)
Function (paralog2):Plant protein of unknown function (DUF639)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.86992075606097
Log2 mRNA fold difference:0.16699493660886
Log2 TE fold difference:-1.0541814489264
Sequences
Protein sequence

MSSRTMDVLEGLVKDSSLKWLLGKQSSFDEEIEEIENSPSAGANWIPELSPVANVVIRRC
SKILGVAVSELQDSFKQEASESVKQPSMFPRNFLEYCCFRALALSVGVTGHLSDKSFRRL
TFDMMVAWEVPSAASQTLLSVDEDPTVGLEAFSRIAPAVPIIADVIICENLFGILTSVSN
SVRLQFYVYDKYLYGLERAIKKMKSQSESSLLSGVRSKGEKILELDGTVTTQPVLEHIGI
STWPGRLILTDHSLYFEAIKVVSFDTPKRYSLSDDLKQVIKPELTGPWGTRLFDKAVSYK
SISLPEPVVMEFPELKGHTRRDYWLAIILEVLYVHRYIKKFKINSVAKDEAISKAVLGIL
RVQAIQEVGLTNPVRYENLLPFNLCDQLPGGDRILETLAEMSSSRVLDRTAKAKEGTLHS
ISASDMVSQLGLVFGATSPKSRSSLVVGEVMVGDVNPLEKAVKQSRKNYEKVVLAQETVN
GVKVDGIDTNVAVMKELLLPATEIGNWLLSLVYWEDPLKSFVFCLLSTFIIYRGWIGYVF
AIATLFIAGFMVLTRYFSNREKVMIELKVMAPPPMNTMEQLLAVQNAISQLEQLIQDANI
VLLKFRALLLSLFPQASEKFAVAIVIAATMMALVPWNNLILVVFLELFTRYSPPRRASTE
RLMRRLKEWWFSIPAAPVLLEQSKDDNKKTK

MSSKTRNMLEGLVRDTSFKWLLGKQSSFDEEIEEMGRSPSAGTNWIPELSPIANVVVRRC
SKILGVSANELRDSFKQEAFESLKQPSLFPRNFLEYCCFRALSLSVGVTGHLADKKFRRL
TFDMMVVWEVPAVASQALLSVEEDATVSLEAFSRIAPAVPIIADVIICDNLFQMLTSSTG
GRLQFSVYDKYLHGLERAIKKMRTQSESSLLSGVRSKREKILEIDGTVTTQPVLEHVGIS
TWPGRLILTDHSLYFEALKVVSYDTPKRYHLSEDLKQIIKPELTGPWGTRLFDKAVSYQS
ISLSEPVVMEFPELKGHTRRDYWLTIIQEVLYVHRYINKYKITGLARDEALSKAVLGVMR
VQALQELNLTNAMRYENLLPFNLCDQLPGGDLILETLAEMSTSRELHRSNKSKDTGTLHS
SASDMVSQLGSVFGGSSPRSRRETSSLVVGEVVVGDVNPLERAVKESRKKYEKVVLAQET
INGVKMGGIDTNLAVMKELMLPIMETWNLILSVVYWDDPTKSSVFCLLTTFIIWRGWLVY
VFALASLFSAIFMVLTRCFSREKLMIELKVTAPPPMNTMEQLLAVQNGISELEQNIQDAN
IVLLKFRALLFSLFPQASQKFAIAIVVAATMMAFVPGRYLLSVVFVELFTRYSPPRRAST
ERLIRRLREWWFSIPAAPVVLLHDKNNKKKKN

www.000webhost.com

Other information
Ka divergence:-0.00784728KaKs divergence:0.308602
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2076Length 2 (bp):2079Length divergence:0.001
MFE 1 (kcal):-646.91MFE 2 (kcal):-633.72MFE divergence-0.01