Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48920-AT3G18610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nucleolin like 1
Function (paralog2):nucleolin like 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-6.2356558115144
Log2 mRNA fold difference:-6.3079356942743
Log2 TE fold difference:0.45206998832084
Sequences
Protein sequence

MGKSKSATKVVAEIKATKPLKKGKREPEDDIDTKVSLKKQKKDVIAAVQKEKAVKKVPKK
VESSDDSDSESEEEEKAKKVPAKKAASSSDESSDDSSSDDEPAPKKAVAATNGTVAKKSK
DDSSSSDDDSSDEEVAVTKKPAAAAKNGSVKAKKESSSEDDSSSEDEPAKKPAAKIAKPA
AKDSSSSDDDSDEDSEDEKPATKKAAPAAAKAASSSDSSDEDSDEESEDEKPAQKKADTK
ASKKSSSDESSESEEDESEDEEETPKKKSSDVEMVDAEKSSAKQPKTPSTPAAGGSKTLF
AANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKALEFHGR
PLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGGDEKKIFVKGFDASLSEDDIKNT
LREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSEGKEKALELNGSDMGGGFYLVVDEPR
PRGDSSGGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRGRFGSGGGRGSDRGR
GRPSFTPQGKKTTFGDE

MGKSSKKSVTEVETPASMTKPLKKGKRDAEEDLDMQVTKKQKKELIDVVQKEKAEKTVPK
KVESSSSDASDSDEEEKTKETPSKLKDESSSEEEDDSSSDEEIAPAKKRPEPIKKAKVES
SSSDDDSTSDEETAPVKKQPAVLEKAKVESSSSDDDSSSDEETVPVKKQPAVLEKAKIES
SSSDDDSSSDEETVPMKKQTAVLEKAKAESSSSDDGSSSDEEPTPAKKEPIVVKKDSSDE
SSSDEETPVVKKKPTTVVKDAKAESSSSEEESSSDDEPTPAKKPTVVKNAKPAAKDSSSS
EEDSDEEESDDEKPPTKKAKVSSKTSKQESSSDESSDESDKEESKDEKVTPKKKDSDVEM
VDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLSSFDD
GSFKGYGHIEFASPEEAQKALEMNGKLLLGRDVRLDLANERGTPRNSNPGRKGEGSQSRT
IYVRGFSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLTSGFDEALQ
LSGSEIGGGNIHVEESRPRDSDEGRSSNRAPARGAPRGRHSDRAPRGGRFSDRAPRGRHS
DRGAPRGRFSTRGRGPSKPSVMESSKGTKTVFNDEE

www.000webhost.com

Other information
Ka divergence:0.0978881KaKs divergence:0.57503
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1674Length 2 (bp):1911Length divergence:0.066
MFE 1 (kcal):-565.33MFE 2 (kcal):-582.35MFE divergence0.015