Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48940-AT3G18590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):early nodulin-like protein 6
Function (paralog2):early nodulin-like protein 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.6969537836424
Log2 mRNA fold difference:-2.8454954947737
Log2 TE fold difference:-0.98872375890198
Sequences
Protein sequence

MGGQKIVLLSIFVCFYVFSLVSCTEFEAGGENGWIIPQSSNQSDIFNQWASKNRFKVGDT
IRFKYKKDSVLVVTEDEYKKCQTTKPELYSNHDDTVFKLDRPGLFYFISGVSGHCEQGQK
MIIKVMEVESTPQSPPPSSSLPASAHKKNHAVRKTSRFLGAGLVTISILVITVFSLV

MDSSKKIIIVMFLVTFYMFSCVSSTEFEVGGENGWIVPKSKTLGDAFNQWASDNRFKVGD
TLRFKYTKDSVLVVSEEEYKKCKATKPQLYSNNEDTVFKLDRPGLFYFISGVSGHCEKGQ
KMIVKVMETESSTESPPPSSSSSSSSSSSLPASTPKAKKSNAFKTAVQFSSSGFVVSAVL
IVSVFGLV

Other information
Ka divergence:-0.0745548KaKs divergence:0.264585
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):534Length 2 (bp):567Length divergence:0.03
MFE 1 (kcal):-140.07MFE 2 (kcal):-150.92MFE divergence0.037