Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49000-AT3G18560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2878270706427
Log2 mRNA fold difference:1.7537621377324
Log2 TE fold difference:-0.5235465137464
Sequences
Protein sequence

MDRSTPEHNSSPSHKRLSVSFLVSMMVLCARHANRLSKKLKLKSKKRTCSGGEGGGERFR
WNMISSSMSSPRPKELFTTLSNKAMTMVRRKNPPEEKATAMEEEHGLWQREILMGGKCEP
LDFSGVIYYDSNGRLLNEVPPRSPRGTPLPSYPTRS

MERSTPEHVSSAHKRISVSFLVSLMVLCARHASRVSKKLKPKKTRKQTHLEDYLESPKSN
GNGSEDGRGGGRFGWSPARTFSPMRVRPKELYTTLSNKAMTMVGRKNKAYDGGPTKKTAV
EMVMEEDEEEYGVWQREILMGGKCEPLDYSGVIYYDCSGHQLKQVPPRSPRASLVPERPT
RSYVGSLLNPTGKEI

Other information
Ka divergence:-0.0907309KaKs divergence:0.361794
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):471Length 2 (bp):588Length divergence:0.11
MFE 1 (kcal):-151.41MFE 2 (kcal):-196.7MFE divergence0.13