Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49140-AT3G18410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Complex I subunit NDUFS6
Function (paralog2):Complex I subunit NDUFS6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.62185937034739
Log2 mRNA fold difference:-0.48291739560049
Log2 TE fold difference:-0.11361754103106
Sequences
Protein sequence

MGRKKGLPEFEESAPDGFDPENPYKDPVAMVEMREHIVREKWIHIEKAKILREKVKWCYR
VEGVNHYQKCRHLVQQYLDATRGVGWGKDHRPISLHGPKPVAVEEAE

MGRKKGLPEFEESAPDGFDPENPYKDPVAMVEMREHIVREKWIQIEKAKILREKVKWCYR
VEGVNHYQKCRHLVQQYLDSTRGVGWGKDHRPISLHGPKPEAVEAE

Other information
Ka divergence:-0.752898KaKs divergence:-0.223796
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):324Length 2 (bp):321Length divergence:-0.005
MFE 1 (kcal):-103.6MFE 2 (kcal):-96.9MFE divergence-0.033