Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49160-AT3G18750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):with no lysine (K) kinase 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.74929906570057
Log2 mRNA fold difference:0.14714294951316
Log2 TE fold difference:0.69883027943538
Sequences
Protein sequence

MEGSEDASAIVEPPDPEVLEIDPTCRYIRYKEVIGKGASKTVFKGFDEVDGIEVAWNQVR
IDDLLQSPDCLERLYSEVRLLKSLKHKNIIRFYNSWIDDKNKTVNIITELFTSGSLRQYR
KKHRKVNMKAVKCWARQILTGLKYLHSQDPPIIHRDIKCDNIFINGNHGEVKIGDLGLAT
VMEQANAKSVIGTPEFMAPELYDENYNELADIYSFGMCMLEMVTFEYPYCECRNSAQIYK
KVSSGIKPASLSKVKDPEVMKFIEKCLLPASERLSAEELLLDSFLNVNGLVMNNPLPLPD
IVMPKEGSFGERCLMSEGPPNARNRTMSMNLDEDNNLPIVISSNNSGTNCIEVRRAKRGN
FFVLKGEENDENSVSLILRIVDENGRVRNIHFLFFQEGDTASNVSSEMVEQLELTDKNVK
FIAELIDVLLVNLIPNWKTDVAVDHLIHPQQNQSSKDNHQNGASSQAGESISHSLSSDYC
PRSDDEANPTVAATTEDQEAEKPGSLEEEEEDERLKEELEKIEERFREEMKEITRKREEA
TMETKNRFFEKKMQQVE

MEGTDDASALQEPPDPEVLEVDPTFRYIRYKEVIGKGAFKTVYKAFDEVDGIEVAWNQVR
IDDVLQSPNCLERLYSEVRLLKSLKHNNIIRFYNSWIDDKNKTVNIITELFTSGSLRHYR
KKHRKVNMKAVKNWARQILMGLRYLHGQEPPIIHRDLKCDNIFINGNHGEVKIGDLGLAT
VMEQANAKSVIGTPEFMAPELYDENYNELADIYSFGMCMLEMVTFDYPYCECKNSAQIYK
KVSSGIKPASLSRVKDPEVKQFIEKCLLPASERLSAKELLLDPFLQLNGLTMNNPLPLPD
IVMPKEGAFGDRCLMSEGPPTTRPSKTLSIDLDEDSNLPIVTFSDNSGSRCIEVRRAKRG
NFFVLKGEENDEQSVSLILRIVDENGRVRNIHFLFYQEGDTASKVSSEMVEQLELTDQNV
TFIAELIDILLVNMIPTWKTDVTVDHLIHSQLNQNSRSHHNEAKPQKQEETVFHDTCELV
SHSCNSDCPRSDEEDKQCVDATKGEDKSSIQEVEEATEPVSLEEEERLRQELEEIEAKYQ
EDMKEIATKREEAIMETKKKLSLMKLK

www.000webhost.com

Other information
Ka divergence:0.175555KaKs divergence:0.999942
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1674Length 2 (bp):1704Length divergence:0.009
MFE 1 (kcal):-450.15MFE 2 (kcal):-462.26MFE divergence0.013