Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49200-AT1G49210
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.4249105286618
Log2 mRNA fold difference:-3.8846839376256
Log2 TE fold difference:0.6408308935818
Sequences
Protein sequence

MAANELASSSVQAFQEQSLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVL
MLLSVLICGIICCLGLHYIIRCAFRRTSSFMISEPIAGLSTPCGSSNKGINKKALRMFPV
VSYSPEMNLPGLGEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCRHC
LVETCQKILGDFSQADQVAATPTASVIVRIAPLEPEGRVNILRESS

MSANELPASAQSLQEQFLGSFVTRKLLLHDPFDHNSLRVFAVAPSPLITHENNLKGNVLM
LLSVLICGIICCLGLHYIIRCAFRRSSRFMISEPISSLSTPRSSSNKGIKKKALRMFPVV
SYSREMNLPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCL
VETCQKILGDFSQADSMASTPTESVIVRIDPLEPEGRVNTFRESS

Other information
Ka divergence:-0.613514KaKs divergence:-0.999832
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):681Length 2 (bp):678Length divergence:-0.002
MFE 1 (kcal):-200.8MFE 2 (kcal):-189.5MFE divergence-0.029