Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49220-AT3G18773
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.3957373290776
Log2 mRNA fold difference:2.5425135648876
Log2 TE fold difference:0.63879197031876
Sequences
Protein sequence

MSANELPSSAQAFQEQFLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVMM
LLSILICGIICCLGLHYIIRCALRRSTRFMISEPVPSLSSTRGSSNKGIKKKALRMFPVV
SYSPEMNLPGLDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCL
VETCQKILGDFSQADSVTAEPTEIVIVTIVPLEPTEIVIVTIAPLEPTEIVIVMIAPLEP
EGRVNTIREIS

MFSEHLPSSSSQVFQEHFIDSFVSRKLLQQIPFAHNAQQAHVPDKNNLSGNVLMLLSILL
CGIICSLGLHYIIRCAFIRSRSFMISDPISIPSTPRDSSVNKGIKKKALKMLPVVNYSPE
INLPGVGEECVICLSDFVAGEQLRVLPKCNHGFHLRCIDKWLTQHMTCPKCRHCLVDTCQ
KVLSDCDAADQVAATATESIDIRISPLEPEARVATFRESS

www.000webhost.com

Other information
Ka divergence:0.447248KaKs divergence:-0.394133
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):756Length 2 (bp):663Length divergence:-0.066
MFE 1 (kcal):-203MFE 2 (kcal):-178.46MFE divergence-0.064