Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49240-AT3G18780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin 8
Function (paralog2):actin 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.9677111728057
Log2 mRNA fold difference:1.4804637630326
Log2 TE fold difference:0.26482645470566
Sequences
Protein sequence

MADADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEA
QSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRL
DLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEK
NYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS
KAEYDEAGPGIVHRKCF

MAEADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEA
QSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRL
DLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEK
NYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS
KAEYDEAGPGIVHRKCF

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:-0.9375
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1134Length 2 (bp):1134Length divergence:0
MFE 1 (kcal):-356.93MFE 2 (kcal):-359.81MFE divergence0.004