Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49300-AT3G18820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog G3E
Function (paralog2):RAB GTPase homolog G3F

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.4370458133365
Log2 mRNA fold difference:1.0352694387151
Log2 TE fold difference:0.39630313977312
Sequences
Protein sequence

MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSAKSFEDLNNWREEFLIQASPSDPENFPF
VVIGNKIDVDGGSSRVVSEKKARAWCASKGNIPYYETSAKVGTNVEDAFLCITTNAMKSG
EEEEMYLPDTIDVGTSNPQRSTGCEC

MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF
VLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSG
EEEELYLPDTIDVGTSNQQRSTGCEC

www.000webhost.com

Other information
Ka divergence:-0.317945KaKs divergence:-0.153209
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):621Length 2 (bp):621Length divergence:0
MFE 1 (kcal):-190.65MFE 2 (kcal):-189.56MFE divergence-0.003