Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49400-AT3G18880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleic acid-binding, OB-fold-like protein
Function (paralog2):Nucleic acid-binding, OB-fold-like protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.8288297040001
Log2 mRNA fold difference:-4.1532894783351
Log2 TE fold difference:1.5136700221099
Sequences
Protein sequence

MKPVIGTVVSNKMQKSVVVAVDRLFHNKIYNRYVKRTSKFMAHDDKDACNIGDRVKLDPS
RPLSKNKHWIVAEIIKKARIYSPKAAAAAVSASASASSASTTDSSAQSQIPPSSTS

MKAVIGTVVSNKMQMSVVVAVDRLFHNNIYNRYVKRTSKFMAHDEKDSCNIGDRVKLDPS
RPLSKHKHWIVSEIIKKARIYSPQAAAAALNSSTSIAEQPPVSSS

www.000webhost.com

Other information
Ka divergence:0.234996KaKs divergence:0.376761
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):351Length 2 (bp):318Length divergence:-0.049
MFE 1 (kcal):-79.3MFE 2 (kcal):-88.65MFE divergence0.056