Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49450-AT3G18950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.3350316285363
Log2 mRNA fold difference:-2.7353989272003
Log2 TE fold difference:0.37023770521841
Sequences
Protein sequence

MAIEENRSHNDYLRRMTFAAFLKSGSLAAEEETYHSDGDHHNQSTFSSNSDSQRPSNASS
ASSDSSSPIYPLSPWNQTYYPSNDNTTSFSSVTQSPWNQTYSPYHKSPWIYQTRNSDFED
DPDNGLIGTVVRQEGHVYSLAASGDLLFTGSDSKNIRVWKDLKDFSGFKSTSGFVKAIVV
TRDNRVFTGHQDGKIRVWRGSKKNPEKYSRVGSLPTLKEFLTKSVNPRNYVEVRRRKNVL
KIRHFDAVSCLSLNEDLGLLYSGSWDKTLKVWRLSDSKCLESIEAHDDAVNTVVSGFDDL
VFTGSADGTLKVWKREVQGKEMKHVLVQVLMKQENAVTALAVNLTDAVVYCGSSDGTVNF
WERQKYLTHKGTIHGHRMAVLCLATAGSLLLSGGADKNICVWKRNGDGSHTCLSVLMDHE
GPVKCLAAVEEAEEDHNDGDDGGEKGDQRWIVYSGSLDNSVKVWRVTDYAS

MVIATETTSSSHHRRLTFASFLNSDPAADEEEQSHGVDDIINPSSSNKNINKDVHHNYRQ
SQSNASTTSGESSPNQVLSPWNQTYSPYYTDTTNTPSMSPSPWNQTYSPYYKSPWIYQTR
NIDDDTDNGLIGTIVRQDGHVYSLAASGDLLFTGSDSKNIRVWKDLKDHTGFKSTSGLVK
AIVITGDNRIFTGHQDGKIRVWRGSKRRTGGYSRIGSLPTLKEFLTKSVNPKNYVEVRRR
KNVLKIRHYDAVSCLSLNEELGLLYSGSWDKTLKVWRLSDSKCLESIQAHDDAINTVAAG
FDDLLFTGSADGTLKVWKRELQGKGTKHFLVNVLMKQENAVTALAVNITAAVVYCGSSDG
TVNFWEGQKYLSHGGTLRGHRLAVLCLAAAGSLVLSGGADKNICVWRRNGDGSHSCLSVL
MDHVGPVKCLTAVEDDGEGHREKGDQKWIVYSGSLDKSVKVWRVTESASTVIG

www.000webhost.com

Other information
Ka divergence:-0.0704005KaKs divergence:0.306296
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1416Length 2 (bp):1422Length divergence:0.002
MFE 1 (kcal):-444.55MFE 2 (kcal):-466.23MFE divergence0.024