Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49480-AT3G18990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):related to vernalization1 1
Function (paralog2):AP2/B3-like transcriptional factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3126786136066
Log2 mRNA fold difference:-2.4229484720832
Log2 TE fold difference:1.1102890389329
Sequences
Protein sequence

MQMDSAQNQFNKRARLFEDPELKDAKVIYPSNPESTEPVNKGYGGSTAIQSFFKESKAEE
TPKVLKKRGRKKKNPNPEEVNSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAAK
TFEPTNPYFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAG
RAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFVLEVTAFRVNEYV

MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIW
FQDGWQEFVDRYSIRIGYLLIFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRA
RLFEDLEDEDAEVIFPSSVYPSPLPESTVPANKGYASSAIQTLFTGPVKAEEPTPTPKIP
KKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFS
QGWYEFTLENNLGEGDVCVFELLRTRDFVLKVTAFRVNEYV

www.000webhost.com

Other information
Ka divergence:-0.999043KaKs divergence:-0.82914
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):681Length 2 (bp):1026Length divergence:0.202
MFE 1 (kcal):-187.2MFE 2 (kcal):-287.87MFE divergence0.212