Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49490-AT3G19020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.90952169000638
Log2 mRNA fold difference:0.97456563950114
Log2 TE fold difference:-0.096189510443572
Sequences
Protein sequence

MERPFGCFFILLLISYTVVATFDDEPSFPENADLTKDLEQKCFSINKVDPNLKFENDRLK
RAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDSLTVVAGVDLNHADIA
GHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNRFVGQFPEVSLSWPS
LKFLDLRYNEFEGSLPSEIFDKDLDAIFLNNNRFESVIPGTIGKSKASVVTFANNKFSGC
IPKSIGNMKNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGFVGSLPSTLSGLASVE
QLDLSHNKLTGFVVDKFCKLPNLDSFKFSYNFFNGEAESCVPGRNNGKQFDDTNNCLQNR
PSQKPAKQCLPVVSRPVDCSKDKCSGGSNGGSSPSPNPPRTSEPKPSKPEPVMPKPSDSS
KPETPKTPEQPSPKPQPPKHESPKPEEPENKHELPKQKESPKPQPSKPEDSPKPEQPKPE
ESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPM
PSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVF
SPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPT
PSSETTQVPTPSSESDQSQILSPVQAPTPVQSSTPSSEPTQVPTPSSSESYQAPNLSPVQ
APTPVQAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPVQSPTPSSEPVS
SPEQSEEVEAPEPTPVNPSSVPSSSPSTDTSIPPPENNDDDDDGDFVLPPHIGFQYASPP
PPMFQGY

MTRRTMEKPFGCFLLLFCFTISIFFYSAAALTDEEASFLTRRQLLALSENGDLPDDIEYE
VDLDLKFANNRLKRAYIALQAWKKAFYSDPFNTAANWVGPDVCSYKGVFCAPALDDPSVL
VVAGIDLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRF
VGPFPTVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTA
SVVTFAHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVG
SLPSTLSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQE
KQFDDTSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCAGGGGGGSNPSPKPTPTPKAPEP
KKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKP
KPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPK
QETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKM
GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV
FSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP
PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHS
PPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPS
SSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPSSEPEVEA
PKQSEATPSSSPPSSNPSPDVTAPPSEDNDDGDNFILPPNIGHQYASPPPPMFPGY

www.000webhost.com

Other information
Ka divergence:-0.400234KaKs divergence:0.225723
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):2544Length 2 (bp):2871Length divergence:0.06
MFE 1 (kcal):-588.27MFE 2 (kcal):-642.98MFE divergence0.044