Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49520-AT3G19080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SWIB complex BAF60b domain-containing protein
Function (paralog2):SWIB complex BAF60b domain-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.88877449407584
Log2 mRNA fold difference:0.36532279578736
Log2 TE fold difference:0.22174261525626
Sequences
Protein sequence

MVSDSDLVTQLREILRSSDLETTTPASVRRQLEVYFGVELTDKKAFVREQIDAFLESDAL
LESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKAKKRGGGFNKICQLSPQLEKFLGTSQ
LARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWALN
DGDGCFKNVKEEDVDETSGERDEKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAKS
EEKPKKKGGGFTKVCSLSPELQAFTGTPQLARTEVVKMLWKYIKENNLQDPSDKRTIICD
ESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEAGTTNDPEKGKQKMKMETDEDNDESNE
EKATSSRIKTEE

MVSDLDLVTRLREILGSSDLNTATPASVRRQLEADFGVDLTDKKAYIRDQIDTFLESNGA
VEDKPESPKVEEYINADEIKAEIEGGDGEDLDGDGSGSEEEKEERPVKAKKRGGGITKVS
QLSPQLEKVVGASQLGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHSLFRVKTINMF
QMNKALTKHIWPLGDGDGCANDVKEEDEDEASEGTDKKGEQSEEVEENKEEESEEQEVRS
LRKRKRKKPAKSVEKPKRKGGGGFAKVCSLSPELQAFTGVTELARTEVVKLLWKYIKENN
LQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHIWPLEDNAGESVSSKSPKNGKQK
MESDGDSEEPNEKDKKQKKEVLAPLPLSDALVKFLGDGENSLSRADVVKRLWEYINHNDL
QDPSDKRRVICDEKLKELFEVDSFEDTSVSKLLTNHFIKAEQ

www.000webhost.com

Other information
Ka divergence:-0.00781617KaKs divergence:0.0771831
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1119Length 2 (bp):1389Length divergence:0.108
MFE 1 (kcal):-288.4MFE 2 (kcal):-394.15MFE divergence0.155