Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49580-AT3G19100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-dependent protein kinase (CDPK) family protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.30174710081248
Log2 mRNA fold difference:0.36819054575868
Log2 TE fold difference:-0.07466834118392
Sequences
Protein sequence

MGGCTSKPSTSSGRPNPFAPGNDYPQIDDFAPDHPGKSPIPTPSAAKASPFFPFYTPSPA
RHRRNKSRDVGGGGESKSLTSTPLRQLRRAFHPPSPAKHIRAALRRRKGKKEAALSGVTQ
LTTEVPQREEEEEVGLDKRFGFSKEFHSRVELGEEIGRGHFGYTCSAKFKKGELKGQVVA
VKIIPKSKMTTAIAIEDVRREVKILQALSGHKNLVQFYDAFEDNANVYIAMELCEGGELL
DRILARGGKYSENDAKPVIIQILNVVAFCHFQGVVHRDLKPENFLYTSKEENSQLKAIDF
GLSDFVRPDERLNDIVGSAYYVAPEVLHRSYTTEADVWSIGVIAYILLCGSRPFWARTES
GIFRAVLKADPSFDEPPWPFLSSDAKDFVKRLLFKDPRRRMSASQALMHPWIRAYNTDMN
IPFDILIFRQMKAYLRSSSLRKAALRALSKTLIKDEILYLKTQFSLLAPNKDGLITMDTI
RMALASNATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAAINVHQHESLDCWEQSIRHA
YELFDKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFVKLLHGVSVRA
SGKTTR

MGGCTSKPSSSVKPNPYAPKDAVLQNDDSTPAHPGKSPVRSSPAVKASPFFPFYTPSPAR
HRRNKSRDGGGGESKSVTSTPLRQLARAFHPPSPARHIRDVLRRRKEKKEAALPAARQQK
EEEEREEVGLDKRFGFSKELQSRIELGEEIGRGHFGYTCSAKFKKGELKDQEVAVKVIPK
SKMTSAISIEDVRREVKILRALSGHQNLVQFYDAFEDNANVYIVMELCGGGELLDRILAR
GGKYSEDDAKAVLIQILNVVAFCHLQGVVHRDLKPENFLYTSKEENSMLKVIDFGLSDFV
RPDERLNDIVGSAYYVAPEVLHRSYTTEADVWSIGVIAYILLCGSRPFWARTESGIFRAV
LKADPSFDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWIAGYKKIDIPFDILI
FKQIKAYLRSSSLRKAALMALSKTLTTDELLYLKAQFAHLAPNKNGLITLDSIRLALATN
ATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN
GNRVIVIEELASELGVGSSIPVHTILNDWIRHTDGKLSFLGFVKLLHGVSTRQSLAKTR

www.000webhost.com

Other information
Ka divergence:-0.0326684KaKs divergence:0.0348418
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1821Length 2 (bp):1800Length divergence:-0.006
MFE 1 (kcal):-559.85MFE 2 (kcal):-567.98MFE divergence0.007