Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49600-AT3G19130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding protein 47A
Function (paralog2):RNA-binding protein 47B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.66093296425622
Log2 mRNA fold difference:0.54218143647863
Log2 TE fold difference:0.18048070993463
Sequences
Protein sequence

MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAM
AMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKT
LWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSF
SGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSV
KGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQ
QNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPV
GKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQ
GYNNGYANQDSNMYATAAAAVPGAS

MQTTNGSDSTLATSGATPPNQQTPPPPQQWQQQQQQQQQWMAAMQYPPAAAMMMMQQQQM
LMYPHQYVPYNQGPYQQHHPQLHQYGSYQQHQHQQHKAIDRGSGDDVKTLWVGDLLHWMD
ETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQNYSGSVMPNSDQP
FRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNT
GRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVILAG
GHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGF
VQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQWRGDSGQQWNGGYSRGHGYNNGG
GYANHHDSNNYHGEN

Other information
Ka divergence:-0.0233378KaKs divergence:0.314449
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1338Length 2 (bp):1308Length divergence:-0.011
MFE 1 (kcal):-423.14MFE 2 (kcal):-435.14MFE divergence0.014