Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49620-AT3G19150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cyclin-dependent kinase inhibitor family protein
Function (paralog2):KIP-related protein 6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4953637528832
Log2 mRNA fold difference:0.5047167236586
Log2 TE fold difference:1.0056247602521
Sequences
Protein sequence

MSETKPKRDSEYEGSNIKRMRLDDDDDVLRSPTRTLSSSSSSSLAYSVSDSGGFCSVALS
EEEDDHLSSSISSGCSSSETNEIATRLPFSDLEAHEISETEISTLLTNNFRKQGISSSEN
LGETAEMDSATTEMRDQRKTEKKKKMEKSPTQAELDDFFSAAERYEQKRFTEKYNYDIVN
DTPLEGRYQWVSLKP

MSERKRELAEEASSTSFSPLKKTKLNDSSDSSPDSHDVIVFAVSSSSVASSAALASDECS
VTIGGEESDQSSSISSGCFTSESKEIAKNSSSFGVDLEDHQIETETETSTFITSNFRKET
SPVSEGLGETTTEMESSSATKRKQPGVRKTPTAAEIEDLFSELESQDDKKKQFIEKYNFD
IVNDEPLEGRYKWDRL

Other information
Ka divergence:0.267708KaKs divergence:0.536763
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):588Length 2 (bp):591Length divergence:0.003
MFE 1 (kcal):-178.66MFE 2 (kcal):-178.86MFE divergence0.001