Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49710-AT3G19280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fucosyltransferase 12
Function (paralog2):fucosyltransferase 11

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0593534031157
Log2 mRNA fold difference:-2.1381890179117
Log2 TE fold difference:1.0932948881912
Sequences
Protein sequence

MGVFSNLRGPRAGATHDEFPATNGSPSSSSSPSSSIKRKLSNLLPLCVALVVIAEIGFLG
RLDKVALVDTLTDFFTQSPSLSQSPPARSDRKKIGLFTDRSCEEWLMREDSVTYSRDFTK
DPIFISGGEKDFQWCSVDCTFGDSSGKTPDAAFGLGQKPGTLSIIRSMESAQYYPENDLA
QARRRGYDIVMTTSLSSDVPVGYFSWAEYDIMSPVQPKTERAIAAAFISNCGARNFRLQA
LEALMKTNIKIDSYGGCHRNRDGKVDKVEALKRYKFSLAFENTNEEDYVTEKFFQSLVAG
SVPVVVGPPNIEEFAPASDSFLHIKTMEDVEPVAKRMKYLAANPAAYNQTLRWKYEGPSD
SFKALVDMAAVHSSCRLCIFLATRVREQEEESPNFKKRPCKCSRGGSDTVYHVFVRERGR
FEMESVFLRGKSVTQEALESAVLAKFKSLKHEAVWKKERPGNLKGDKELKIHRIYPLGLT
QRQALYNFKFEGNSSLSSHIQNNPCAKFEVVFV

MGVFSNLRGPKIGLTHEELPVVANGSTSSSSSPSSFKRKVSTFLPICVALVVIIEIGFLC
RLDNASLVDTLTHFFTKSSSDLKVGSGIEKCQEWLERVDSVTYSRDFTKDPIFISGSNKD
FKSCSVDCVMGFTSDKKPDAAFGLSHQPGTLSIIRSMESAQYYQENNLAQARRKGYDIVM
TTSLSSDVPVGYFSWAEYDIMAPVQPKTEKALAAAFISNCAARNFRLQALEALMKTNVKI
DSYGGCHRNRDGSVEKVEALKHYKFSLAFENTNEEDYVTEKFFQSLVAGSVPVVVGAPNI
EEFAPSPDSFLHIKQMDDVKAVAKKMKYLADNPDAYNQTLRWKHEGPSDSFKALIDMAAV
HSSCRLCIFVATRIREQEEKSPEFKRRPCKCTRGSETVYHLYVRERGRFDMESIFLKDGN
LTLEALESAVLAKFMSLRYEPIWKKERPASLRGDGKLRVHGIYPIGLTQRQALYNFKFEG
NSSLSTHIQRNPCPKFEVVFV

www.000webhost.com

Other information
Ka divergence:-0.000278629KaKs divergence:0.0595611
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1542Length 2 (bp):1506Length divergence:-0.012
MFE 1 (kcal):-472.72MFE 2 (kcal):-445.53MFE divergence-0.03