Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49720-AT3G19290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):abscisic acid responsive element-binding factor 1
Function (paralog2):ABRE binding factor 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2065198333931
Log2 mRNA fold difference:1.258087768237
Log2 TE fold difference:0.023163168426703
Sequences
Protein sequence

MGTHIDINNLGGDTSRGNESKPLARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNI
WTAEDTQAFMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLNSKEG
SNGNTGTDALERQQTLGEMTLEDFLLRAGVVKEDNTQQNENSSSGFYANNGAAGLEFGFG
QPNQNSISFNGNNSSMIMNQAPGLGLKVGGTMQQQQQPHQQQLQQPHQRLPPTIFPKQAN
VTFAAPVNMVNRGLFETSADGPANSNMGGAGGTVTATSPGTSSAENNTWSSPVPYVFGRG
RRSNTGLEKVVERRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDLQKKQAEI
MKTHNSEVITFFLYLSKGIFEAASIAGQKTMLEKNPYRSVVRR

MGTHINFNNLGGGGHPGGEGSSNQMKPTGSVMPLARQSSVYSLTFDELQNTLGGPGKDFG
SMNMDELLKSIWTAEEAQAMAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQK
TVDEVWKCLITKDGNMEGSSGGGGESNVPPGRQQTLGEMTLEEFLFRAGVVREDNCVQQM
GQVNGNNNNGFYGNSTAAGGLGFGFGQPNQNSITFNGTNDSMILNQPPGLGLKMGGTMQQ
QQQQQQLLQQQQQQMQQLNQPHPQQRLPQTIFPKQANVAFSAPVNITNKGFAGAANNSIN
NNNGLASYGGTGVTVAATSPGTSSAENNSLSPVPYVLNRGRRSNTGLEKVIERRQRRMIK
NRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKNEQLKETSKRPWGSK
RQCLRRTLTGPW

Other information
Ka divergence:-0.460802KaKs divergence:-0.506677
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1212Length 2 (bp):1299Length divergence:0.035
MFE 1 (kcal):-375.5MFE 2 (kcal):-424.35MFE divergence0.061