Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49730-AT3G19300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.84935033596209
Log2 mRNA fold difference:-0.82849416239573
Log2 TE fold difference:1.6655645054408
Sequences
Protein sequence

MSYSHRDLPLNSFFIISFSLLSFSLWLLLAMVVNSQAFLLALIALLATQLPSLMAADCPL
DFSGSNFTLVATVCSNITNRGKCCRYMNAFVAVSVARYANLSTNLGVTSDLSETCIASIS
RAMEGYGVSRNATSFCGLGTKILVKYDCDGRTTVTQMHQSPGFGHVSRNCRLPFSPGHQC
RKCLNSGITYLRNLIGAETNNITLCTCRDATYATLASRIDDTSALELLSCFFQVTELNIP
SESFSPVASPEPSPSTVGGISPSNSDSQMTTSRSTNPYHLTMVPTIGIVVTAVALTMLVV
LVILIRRKNRELDESESLDRKSTKSVPSSLPVFKIHEDDSSSAFRKFSYKEMTNATNDFN
TVIGQGGFGTVYKAEFNDGLIAAVKKMNKVSEQAEQDFCREIGLLAKLHHRNLVALKGFC
INKKERFLVYDYMKNGSLKDHLHAIGKPPPSWGTRMKIAIDVANALEYLHFYCDPPLCHR
DIKSSNILLDENFVAKLSDFGLAHSSRDGSVCFEPVNTDIRGTPGYVDPEYVVTQELTEK
SDVYSYGVVLLELITGRRAVDEGRNLVEMSQRFLLAKSKHLELVDPRIKDSINDAGGKQL
DAVVTVVRLCTEKEGRSRPSIKQVLRLLCESCDPVHSAFAKAVEEEIGWDSRKRSNLRIQ
RGDSRIFGPSSSTTSRSHYSRSLPHSPINGFSF

MVLVYNQALLLAFFALLGFQYFPLLTEAGCPLDFTSSNFTLVASVCSNNTERAKCCRYMN
AFVAISVARYANYTADLGVTSDLTEICITTISRTMELYGIPRNATIFCGLGTKILVNYDC
EGLTTVPPMLHSTSFGDVSRNCKLPLPPGDQCRNCLNSSISYLRSLVGADNSIKLSTCRD
ATYAVLASRVDNSSALELASCFFNVPELSPTPGSSPSSLSPEASPPVLADSPSSDNLVLS
PLKSHHPYHLTMVPTIGIAVTVFALVMVVVLIVLIQRKKRELDDSKSIACNLTRTSPSPR
PRSMIHEGNSFGFRKFSYKEIRKATEDFNAVIGRGGFGTVYKAEFSNGLVAAVKKMNKSS
EQAEDEFCREIELLARLHHRHLVALKGFCNKKNERFLVYEYMENGSLKDHLHSTEKSPLS
WESRMKIAIDVANALEYLHFYCDPPLCHRDIKSSNILLDEHFVAKLADFGLAHASRDGSI
CFEPVNTDIRGTPGYVDPEYVVTHELTEKSDVYSYGVVLLEIITGKRAVDEGRNLVELSQ
PLLVSESRRIDLVDPRIKDCIDGEQLETVVAVVRWCTEKEGVARPSIKQVLRLLYESCDP
LHLGLAMAVEENKGRSLRGDSGFQSGDIRGLASSSSTTSRSHCSRSFLLETGSPHSPPNG
LSF

www.000webhost.com

Other information
Ka divergence:-0.0424699KaKs divergence:-0.341036
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):2082Length 2 (bp):1992Length divergence:-0.022
MFE 1 (kcal):-613.74MFE 2 (kcal):-600.72MFE divergence-0.011