Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49750-AT3G19320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.3666419815065
Log2 mRNA fold difference:-5.5543649129511
Log2 TE fold difference:1.1892315791293
Sequences
Protein sequence

MASILSILLLILSLSNLHFTSTTGNNHINDRKSLEIIIGGGNDNNPPPSPSPEPEPEPAD
CPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFA
SSLLKKVYPVLQRFKDLVADDKLKSWEGPDICNKYLGLKCAIFPKTKHLALASVQFNGLN
LRGKIGKILKLDNFLDKLEEVTIFHANSNGFTGSVPDFSNLKFLYELDLSNNKLTGDFPT
SVLKGNNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQKLPLNLGSITALYLTFA
NNRFTGPIPESIGNIKYLQEVLFLNNKLTGCLPYQIGNLTRATVFDVGFNQLTGPIPYSF
GCLETMEQLNLAGNKFYGTIPEIVCEIACLQNVSLSNNYFTQVGPKCRKLIKRKIMDVSM
NCILDLPNQKTPSECAKFFMRKQTCPNSKSLFTVPCDKNPNRGKPDQERLEEEKAQVSHP
VTYNTLNPDRLRNL

MAPNYYPSIFLILSVHFLSILATGNNHNTYRKSLEIIIGGGSDSTNYNSPAPSPEPEDYL
PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFS
SPLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICAQDKYIGLECAKLPGTNDLALASIQ
FNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGSVPNFSKLKYLFELDLSNNKLSGEF
PSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALYLT
FANNRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVELNQLTGPIPY
SFGCLKKMEQLNLARNNFYGTIPEIVCELSALKNLSLSYNYFTQVGPKCRTLIKRKILDV
GMNCILDLTNQRTPWECAKFFLRKQSCPNFKSFFYLPCGKDPHRIKPDQEGSDGQASPPV
SYNALNPDRIRNL

Other information
Ka divergence:0.0255088KaKs divergence:-0.665073
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1485Length 2 (bp):1482Length divergence:-0.001
MFE 1 (kcal):-325.51MFE 2 (kcal):-357.59MFE divergence0.047