Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49780-AT3G19380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant U-box 26
Function (paralog2):plant U-box 25

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6022613461596
Log2 mRNA fold difference:0.72508227314313
Log2 TE fold difference:0.85670651796742
Sequences
Protein sequence

MPGNLEPLDLGIQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRV
ALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHVS
VRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADIETTSLSSELVSESLALLV
LLHMTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGS
DSIFEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDR
CDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEE
RCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAP
F

MPRNIEPLDLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTR
APLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTHV
SVRSRAAALRRLRGFARDSDKNRVLIAAHNATEILIKILFSETTSSELVSESLALLVMLP
ITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSES
VFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCD
TERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERW
REEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVP
F

Other information
Ka divergence:0.051025KaKs divergence:0.376503
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1266Length 2 (bp):1266Length divergence:0
MFE 1 (kcal):-450.6MFE 2 (kcal):-453.07MFE divergence0.003