Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49840-AT3G19540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF620)
Function (paralog2):Protein of unknown function (DUF620)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.9024985034064
Log2 mRNA fold difference:0.66206069989722
Log2 TE fold difference:0.21849155400824
Sequences
Protein sequence

MEKKQGFFSSLRDEVVRGLSPSRSRPRSRSASPSRSTTPHMKALLWGRKKLIASSGCSGG
GGVIGGERGGYYLSQPEPFIGRSSSLRPVMEGPDPDNGEVSGVDSKRLGSGLSHWVKGQW
SRAPSVTSTTPAYRKSDLRLLLGVMGAPLAPINVSSSSHLLHLTIRDSPTETSSAQYILQ
QYTAACGGHKLHNAIKNAYAMGKLKMITSELETPTGTVRNRNSTKSETGGFVLWQMNPDM
WYVELSVGGSKVRAGCNGKLVWRHTPWLGSHTAKGPVRPLRRALQGLDPRTTATMFAESK
CVGERKVNGEDCFILKLCTDPETLRARSEGPAEIVRHILFGYFSQRTGLLAQIEDSQLTR
IQSNDGDAVYWETTINSSLDDYKQVEGIMIAHSGRSVVTLFRFGEVAMSHTRTKMEERWT
IEEVAFNVPGLSLDCFIPPADLRSGSLTEACEYSGQEEKGKSSLALASTTAHRAKVAALE
KGSFDNDPVWHIDV

MEKKQGFFSALRHEVVRGLSPSRSRARSRSVSPARSSSPMSALTWGRKNLTGGGGGGGGG
GYYLAQPEQLIGRSGSLRPVMEGPDPDEGGGGGNIGESKRLGSGLGHWVKGQLSRAPSVA
ATAAYRRNDLRLLLGVMGAPLAPIHVSSSDPLPHLSIKNTPIETSSAQYILQQYTAASGG
QKLQNSIKNAYAMGKLKMITSELETATRTVRNRNPSKAETGGFVLWQMNPDMWYVELAVG
GSKVRAGCNGKLVWRHTPWLGSHTAKGPVRPLRRGLQGLDPRTTAAMFAEAKCIGEKKVN
GEDCFILKLCTDPETLKARSEGPAEIIRHVLFGYFSQKTGLLVHIEDSHLTRIQSNGGET
VFWETTYNSSLDDYRQVEGIMIAHSGHSVVTLFRFGEVATSHTRTKMEESWTIEEVAFNV
PGLSLDCFIPPADLKTGSLTESCEYPQEERGKNNTLALSAAHRAKVAALENGSLEDHRPV
WHTDV

Other information
Ka divergence:-0.302728KaKs divergence:-0.455556
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1485Length 2 (bp):1458Length divergence:-0.009
MFE 1 (kcal):-474.21MFE 2 (kcal):-480MFE divergence0.006