Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49890-AT3G19570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Family of unknown function (DUF566)
Function (paralog2):Family of unknown function (DUF566)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0726356031345
Log2 mRNA fold difference:-1.282924429969
Log2 TE fold difference:0.19461550938198
Sequences
Protein sequence

MVAAAISTTDPRNPPRDRPQSLTNNGGQRRPRGKQVPSRYLSPSPSHSVSSTTTTTTTTT
TTTSSSSSSSSSAILRTSKRYPSPSPLLSRSTTNSASNSIKTPSLLPKRSQSVDRRRPSA
VSVTVGTEMSAATKMLITSTRSLSVSFQGEAFSLPISKKKETTSTPVSHRKSTPERRRST
PVRDQRENSKPVDQQRWPGASRRGNSESVVPNSLSRSLDCGSDRGKLGSGFVGRSMLHNS
MIDESPRVSVNGRLSLDLGGRDEYLDIGDDIQRRPNNGLTSSVSCDFTASDTDSVSSGST
NGVQECGSGVNGEISKSKSLPRNIMASARFWQETNSRLRRLQDPGSPLSSSPGLKTSSIS
SKFGLSKRFSSDAVPLSSPRGMASPVRGSAIRSASPSKLWATTTSSPARALSSPSRARNG
VSDQMNAYNRNNTPSILSFSADIRRGKIGEDRVMDAHLLRLLYNRDLQWRFVNARADSTV
MVQRLNAEKNLWNAWVSISELRHSVTLKRIKLLLLRQKLKLASILRGQMGFLEEWSLLDR
DHSSSLSGATESLKASTLRLPIVGKTVVDIQDLKHAVSSAVDVMQAMSSSIFSLTSKVDE
MNSVMVETVNVTAKEKVLLERCQGCLSRVAAMQVTDCSMKTHIIQLSRIPITSSLTPQL

MVAAIPQGAAISNTDSKNPPPRDRQDKPQLTANNGGLQRRPRAAKNVPSRYLSPSPSHST
TTTTTTATSTSTSSSSSVILRSSKRYPSPLLSRTTNSASNLVYTPSSLPKRSQSVDRRRP
SAVSDTRTEMSAATKMLITSTRSLSVSFQGEAFSFPISKKKETATPVSHRKCTPERRRAT
PVRDQRENSKPVDQQLWPGASRRGSSESVVPNSLSRSVDSDSDDGRKLGSGFVGRSMLQH
SQSSRVSGDGRLNLGFVGGDGMLEMRDENKARQSTHPRLASSVSCDFTASDTDSVSSGST
NGAHECGSGEVSKTRSLPRNGMASTKFWQETNSRLRRMQDPGSPQCSSPSSRISSISSKF
SQSKRFSSDSPLTSSPRGMTSPIRGATRPASPSKLWATATSAPARTSSSPSRVRNGVSEQ
MNAYNRTLPSILCFSADIRRGKIGEDRVMDAHLLRLLYNRDLQWRFANARADSTLMVQRL
SAEKILWNAWVSISELRHSVTLKRIKLLLMRQKLKLASILKEQMCYLEEWSLLDRNHSNS
LSGATEALKASTLRLPVSGKAVVDIQDLKHAVSSAVDVMHAMVSSIFSLTSKVEEMNSVM
AEMVNITGKEEVLLEQCQGFLTRVAAMQVTDCSMKTHIIQLSRL

www.000webhost.com

Other information
Ka divergence:0.267052KaKs divergence:0.163829
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1980Length 2 (bp):1935Length divergence:-0.011
MFE 1 (kcal):-609.49MFE 2 (kcal):-617.18MFE divergence0.006