Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G49910-AT3G19590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.617551732252
Log2 mRNA fold difference:0.83928168108271
Log2 TE fold difference:0.83884886557327
Sequences
Protein sequence

MTLVPAIGRELSNPPSDGISNLRFSNNSDHLLVSSWDKSVRLYDANGDLMRGEFKHGGAV
LDCCFHDDSSGFSVCADTKVRRIDFNAGKEDVLGTHEKPVRCVEYSYAAGQVITGSWDKT
IKCWDPRGASGTERTQIGTYMQPERVNSLSLVGNRLVVATAGRHVNIYDLRNMSQPEQRR
ESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFDLSEAAQAKKYAFKCHRKSEDGRDIV
YPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRLYQYSKYPTSIAALSFSRDGGLLAVA
SSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYPNPPV

MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGA
VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKAVRCVEYSYAAGQVITGSWDK
TVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQR
RESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDI
VYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAV
ASSYTFEEGEKSQEPEAIFVRSVNEIEVKPKPKVYPNPAA

Other information
Ka divergence:0.146915KaKs divergence:0.493433
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1020Length 2 (bp):1023Length divergence:0.001
MFE 1 (kcal):-310.3MFE 2 (kcal):-310.55MFE divergence0