Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50040-AT3G19680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1005)
Function (paralog2):Protein of unknown function (DUF1005)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.14479228808
Log2 mRNA fold difference:3.4142513328438
Log2 TE fold difference:0.93339106234789
Sequences
Protein sequence

MDPCSFVRIIVGNLAVRFPRSPSSSSSSSSSSGPSVSDVSSGNCYCKIKFKSFPRQIVSV
PVLLRTESESESRCCSGNVSTVAACFSLSKSQIETSLKKAKWSVLSVEVYSRRSASCGFV
AASGEKLIGRFQVTLDLKAAESKTCLAHNGWVDLGTKSKNNKKSGSDPELHVSVRVEPDT
RFVFQFDGEPECSPQVFQVQGNAKQAVFTCKFGFRNSGDRNLSLSLSSVTSGKEQFSKER
KGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSSPGAWLILRPDGYTWKPWVRLQAW
REPGVSDVLGYRFELYKDGIAVAVSASSSISTKLGGSFIIDGSTSTTTTASWSSSEGSFD
LSSWSSIRSSRTDSGSGSDFRFSLSQAQQNLGFVMSTRVQGVEKQSKPKVEVGVKHVTCT
EDAAAHVALAAAVDLSMDACRLFSQKLRNELRQPSRVDIV

MDPCSFVRIIVGNLAVRFPSSSSSSSSSSGPSVSGINPTAPNCYCKIRFKNFPREIVSVP
VMFRTESESETRCSSSGNVSTVAACFSLSKAQIEASLKKPKFSVLSVEAYSRGNSDGDDG
VSGASCGLATAGEKLLGRFEVSLDLKSAETKSFLAHNGWVALPSKKTKSKTGSDPELHVS
VRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSMMSE
ISSTRSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSP
GAWLILRPDGCTWKPWGRLEAWREAGYSDTLGYRFELFQDGIATAVSASSSISLKNGGSF
VIDVTGGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPSAAAQ
NRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHKLRK
ELRQQSQLGVV

Other information
Ka divergence:-0.221335KaKs divergence:-0.357977
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1383Length 2 (bp):1476Length divergence:0.033
MFE 1 (kcal):-474.7MFE 2 (kcal):-545.2MFE divergence0.069