Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50140-AT3G19740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.064326865713134
Log2 mRNA fold difference:0.093597070739892
Log2 TE fold difference:-0.10986841812238
Sequences
Protein sequence

MYTRTIRRNQRWGFVLQQDKCLVRPVIRDHTGSQSYRSTTSILTDHLRRNHHSHGAIASR
DYLSYSWNSQLRRFSSEGDGNNASEDSRFPLNKDKMGKEKSTVGVEHFDSHAQLGVQDQI
EWLNNEKRASESRKESPFLNKRERLKNEFLRRIQPWETIQLSWESFPYYVHEHTKDTLVE
CVSSHIKQKSMTSKYGARLDSSSGRILLQSVPGTELYRERLVRALARDTQVPLLVLDSSV
LAPYDFADDYNEESESDDDIAESDQCTSQSEAEEETDGDNDDTSSSETKIEGTDDEERYL
EISKEVLKKLGADIEDIEKRMSEQLYGSSEVSEAAAVDQDDKAKRPLKKGDQVKYVGSPK
KDEAKHRVVLGKISTSDGQKSAFTVIPGRPLSSGQRGEVYEVIGNRVAVIFEYGDDKTSE
GSEKKPAEQPQMLPIHWLDVKDLKYDLDMQAVDGYIAMEALNEVLQSIQPLIVYFPDSTQ
WLSRAVPKTRRKEFVDKVKEMFDKLSGPIVMICGQNKIETGSKEREKFTMVLPNLSRVVK
LPLPLKGLTEGFTGRGKSEENEIYKLFTNVMRLHPPKEEDTLRLFKKQLGEDRRIVISRS
NINELLKALEEHELLCTDLYQVNTDGVILTKQKAEKAIGWAKNHYLASCPVPLVKGGRLS
LPRESLEISIARLRKLEDNSLKPSQNLKNIAKDEYERNFVSAVVAPGEIGVKFEDIGALE
DVKKALNELVILPMRRPELFARGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISI
TGSTLTSKWFGDAEKLTKALFSFATKLAPVIIFVDEIDSLLGARGGSSEHEATRRMRNEF
MAAWDGLRSKDSQRILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRLKILKIFLTPE
NLESDFQFEKLAKETEGYSGSDLKNLCIAAAYRPVQELLQEEQKGARAEASPGLRSLSLD
DFIQSKAKVSPSVAYDATTMNELRKWNEQYGEGGSRTKSPFGF

MYTRALKRNQRWGLVLQQAKYLVRPVVRDYTVSRYCGFTNKLTNSENLTRKSLLGSFSPR
GGTIASGNHLSILKNSQLRSFSSEGDGRNASEDKHISLNKENGVDDGKTGKEKSNNGVGH
LDSHAQLGEQDQIEWLNNEKLASECKKKESPFVNRRERFKNEFLRRIQPWEKIQLSWETF
PYYIHDHTKDILVECVTSHIRQKNAASIYGARLDSSSGRILLQSVPGTELYRERLVRALA
RDVQVPLLVLDSSVLAPYDFADDYNEESESDGENAEAEADESTTESDAEEDSSAQSEEDS
EAKADGSDSEEACLEVSEEAIKKIVPKLEEFEKLVAEELHGEACEAAAVEHSDKARRPAK
KGDRVKYVGPSKKADAKHRPLSSGQRGEVYEVNGNRVAVIFDIGGDTSSEGGDKKSTEHS
HKLHMHWIDVGDLKHDLDMQAEDGYIALEALSEVLHSTQPLIVYFPDSSQWLSRAVPKSK
QNEFVDKVQEMFDKLSSPVVMICGRNKIETGSKEREKFTMILPNFGRLAKLPLPLKRLTE
GLTGRKTSEDNEIYKLFTNVMNLVPPKEEENLIVFNKQLGEDRRIVMSRSNLNELLKALE
ENELLCTDLYQVNTDGVILTKQRAEKVIGWARNHYLSSCPSPSIKEGRLILPRESIEISV
KRLKAQEDISRKPTQNLKNIAKDEFETNFVSAVVAPGEIGVKFDDIGALEHVKKTLNELV
ILPMRRPELFTRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWF
GDAEKLTKALFSFASKLAPVIIFVDEVDSLLGARGGAFEHEATRRMRNEFMAAWDGLRSK
DSQRILILGATNRPFDLDDAVIRRLPRRIYVDLPDAENRLKILKIFLTPENLETGFEFDK
LAKETEGYSGSDLKNLCIAAAYRPVQELLQEENKDSVTNASPDLRPLSLDDFIQSKAKVS
PSVAYDATTMNELRKWNEQYGEGGTRTKSPFGF

Other information
Ka divergence:-0.00535742KaKs divergence:-0.0205761
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3012Length 2 (bp):2982Length divergence:-0.005
MFE 1 (kcal):-905.04MFE 2 (kcal):-875.54MFE divergence-0.017