Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50260-AT3G19830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):N-terminal-transmembrane-C2 domain type 5.1
Function (paralog2):Calcium-dependent lipid-binding (CaLB domain) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6600716397587
Log2 mRNA fold difference:0.86777849593118
Log2 TE fold difference:0.82764290274852
Sequences
Protein sequence

MIPQTSSSNFDFRLPVDVSCTLLCPCSNELRAVFFTRSRVLRPSVKISNFRFISCGFRGN
SKNLRLTDSSRKAANRFVIARFTNEFEDEGSSKESNDQANFSNFREDPIVDKLRTQLGVI
HPLPSPTINRSVISLFVFFFFVGVAFDKLWTWRKRQRETGGDGNQRGVGPWPQVPTSFSL
FLEKDLQRKESVEWVNMVLGKLWKVYRAGIENWLVGLLQPVIDDLKKPDYVQRVEIKQFS
LGDEPLSVRNVERKTSRRANDLQYQIGLRYTGGARMLLMLSLKFGVIPIVVPVGVRDFDI
DGELWVKLRLIPTQPWVGAVSCSFVSLPKVTFQLAAFRLFNLMGIPVLSMFLTKLLTVDL
PRLFVRPKKIVLDFQKGKAVGPVLEDLKSGEMQEGNKDFVGELSVTLVDAQKLRYMFFGK
TDPYAILRLGDQVIRSKRNSQTTVIGAPGQPIWNQDFQFLVSNPREQVLQIEVNDRLGFA
DMAIGTGEVDLRFLQDTVPTDRIVVLRGGWSLFGKGSAGEILLRLTYKSYVEEEEDDKTN
VKAIDTSDDEMSDSEELGSFVRKGKLSSDDIDQESFMNVLSALIVSEEFQGIVSSEARDG
IIDGGDSLGAPVPSKPDTSKGSERNADVSNLDLLVANSGRGAGGDGGLALLWFGIITGIL
VLVAINMEGSSFFNP

MILQSSSSCSSFDFPSFVSRRLLCPCSNEHGLIVFSDGFTKRRRILRRVHAANSNSRFVS
SGIRTDSKNIGLADSARRAARSLVVTRFSNEFEDEEASSSSQESAIQGDRNNFTNFREDP
IVDKLRTQLGVIHPIPSPPISRNAIGLFAFFFFVGVICDKLWTWRKRRRQMAGDGGQRGA
GPWAQVPTSFSLSLEKDLQRKESVEWVNMVLVKLWKVYRGGIENWLVGLLQPVIDDLKKP
DYVQRVEIKQFSLGDEPLSVRNVERRTSRRVNDLQYQIGLRYTGGARMLLMLSLKFGIIP
VVVPVGIRDFDIDGELWVKLRLIPSAPWVGAASWAFVSLPKIKFELAPFRLFNLMGIPVL
SMFLTKLLTEDLPRLFVRPKKIVLDFQKGKAVGPVSEDLKSGEMQEGNKDFVGELSVTLV
NAQKLPYMFSGRTDPYVILRIGDQVIRSKKNSQTTVIGAPGQPIWNQDFQFLVSNPREQV
LQIEVNDCLGFADMAIGIGEVDLESLPDTVPTDRFVSLRGGWSLFGKGSTGEILLRLTYK
AYVEDEEDDKRNAKAIYADASDDEMSDSEEPSSFVQNDKIPSDDIGQESFMNVLSALILS
EEFQGIVSSETGNNKVDDGESSVSPVPSMSGADSESRPKDAGNGDVSDLEVKNAKSDRGS
INNGGLALLWFGVITSVLVLVAINMGGSSFFNP

Other information
Ka divergence:-0.101232KaKs divergence:-0.0743802
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2028Length 2 (bp):2082Length divergence:0.013
MFE 1 (kcal):-608.86MFE 2 (kcal):-651.91MFE divergence0.034