Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50280-AT3G19850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phototropic-responsive NPH3 family protein
Function (paralog2):Phototropic-responsive NPH3 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.8282362212502
Log2 mRNA fold difference:2.8517963422781
Log2 TE fold difference:0.076310963487919
Sequences
Protein sequence

MSPLNDLKINLNGQYTFFLNQNVISKYSGSLRKMIKQSKKKRNKKKRIITIEINDFPGGP
DGFELVSRFCYHNGEILIDVSNVSTLYCCSVFLGMSEKFCFSNLFLQTEKFLEEVFYGSW
SDIVSCLKNCEQVFFQADSYGLVDKLIFAALNKISQNSDDFSSSSLSSFASSLSPEMAKN
TSESDGRYISRSVACGRSNEWWFEDMTNLSPKIILKLVMIIGAYKTNIKSLVLTRFLLHY
LKTKLQTKSRTTTELMRNKLEYSDLADTAVRGVISAGTRTFSCRKLFWILRVLSSFSLSR
ESRIGLETLIGEMLEQATLDDLLISARGSRESGFYNVDLVIRLLKVFVKNREEEEEESRE
RNMKEIGKLIDKYLREISPDQNLKVPKFLGVAESLPDSARDCFDGVYRAIDIYLQSHPNL
TPQDRTEICRCLNYKKLTMETCKQLARNPKIPPEIAIEALKSRCGNQEHTTSDVKVANKS
FSCRYSEEKKKPVVLHLEITEKLAERLKTKGGYNLKVMDSFREGL

MSLCCDLQINLNNQFTFFVNQDLISEYSGFLRKMIKQSNKKKKNHKNSRIIIEVEDFPGG
SDGFDLVLRFCYGGGISIDVSNVSILHCSSVFLEMTEKLCSSNLLLRTEKFLEGMFYWSW
NDIVLCLKSCEQVFLHADSYGLVDKLVFGVLAKIPQNSDVSHVFSSSSPSSSASASASSQ
SPETAMIRSYSDKRSTSRSFSCRTSNEWWFDDMSILGPKIIEKLINTLGAHDKNNDSLVL
TKFLLHYLKTKVPNKSTNKLEYSGLADTAVQGVVFAAKTAFSCRKMFWVLRVLSGFSISK
ESRIGLERVIGEMLDQATLDDLLIPAGGKGEKGVYDVDLVIRLLKVFVRIGNTEEGDQNL
RMRRIGKLIDKYLREISPDQNLKVSKFLEVAESLPDSARDWFDGLYRAINIYLESHPKLS
SEDRTKLCRCLNYKKLTLDTCKQLAKNPKIPPNIAVQALKSQQLSNETRPHSREDKNKVN
KIWNSRKYLEEKPILVCLKGFDMSEKFEDDLMMNLERKQWNNSEKVSKEKKSEVMSRSVR
HGHTHSSSSFPRLC

www.000webhost.com

Other information
Ka divergence:-0.237843KaKs divergence:-0.506026
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1578Length 2 (bp):1665Length divergence:0.027
MFE 1 (kcal):-445MFE 2 (kcal):-468.81MFE divergence0.026