Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50360-AT3G19960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):myosin 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.75849183473717
Log2 mRNA fold difference:0.62906646293779
Log2 TE fold difference:0.098101227031433
Sequences
Protein sequence

MAHKVKASFQSLKTMPADYRFLGSPISDHLETNLITPPNGHLKNGVNGTASSVGGMDSVN
EDSPYSVRSILNGERSSIGDGDSILPLPESNDRKWSDTNVYARKKVLQFWVQLPNGNWEL
GKIMSTSGEESVIVVTEGKVLKVKSETLVPANPDILDGVDDLMQLSYLNEPAVLYNLEYR
YNQDMIYTKAGPVLVAVNPFKEVPLYGNRNIEAYRKRSNESPHVYAIADTAIREMIRDEV
NQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLRNDNSS
RFGKLIEIHFSETGKISGAQIQTFLLEKSRVVQCTEGERSYHIFYQLCAGASPTLREKLN
LTSAKQYNYLKQSNCYSINGVDDAERFHAVKEALDIVHVSKEDQENVFAMLAAVLWLGNV
SFTIIDNENHVEPEPDESLSTVAKLIGCNINELKLALSKRNMRVNNDTIVQKLTLSQAID
ARDALAKSIYACLFDWLVEQINKSLAVGKRRTGRSISILDIYGFESFNKNSFEQFCINYA
NERLQQHFNRHLFKLEQEEYIQDGIDWTRVDFEDNQECLSLFEKKPLGLLSLLDEESTFP
NGTDLTLANKLKQHLNDNSCFRGDRGKAFTVAHYAGEVTYETTGFLEKNRDLLHSDSIQL
LSSCSCHLPQAFASSMLIYSEKPLVGPLHKAGGADSQRLSVATKFKGQLFQLMQRLGNTT
PHFIRCIKPNNVQSAGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMFHHKFARRYGFLL
LENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQIGVLEDTRNRTLHGILRLQS
YFRGHQARCRLKELKTGITILQSFVRGEKMRKEYTELLQRHRASAAIQSHVKRRIASQQY
KATVDASAVIQSAIRGELVRRCAGDIGWLSSGGTKRNESDEVLVKASYLSDLQRRVLRTE
AALREKEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVED
SARNSDASVNASDATDLDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRK
FLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKV
KMNWWGRLRSTRY

MSQKVTPFMQSLKSLPADYRFDGSPVSDRLENSSGASVRLTNSNVPRKGGLRNGVSRTDT
AAGDSEDSPYSGHGVFVEEQSLTDDVDSGAATMPLPQSDERRWSDTSAYARKKILQSWIQ
LPNGNWELGKILSTSGEESVISLPEGKVIKVISETLVPANPDILDGVDDLMQLSYLNEPS
VLYNLNYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRYIEAYRKKSNESPHVYAIADTAI
REMIRDEVNQSIIIRCICIHESMTYSISSSSGESGAGKTETAKIAMQYLAALGGGSGIEY
EILKTNPILEAFGNAKTLRNDNSSRFGKLIEIHFSESGKISGAQIQTFLLEKSRVVQCAE
GERSYHIFYQLCAGASPALREKLNLTSAHEYKYLGQSNCYSINGVDDAERFHTVKEALDI
VHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADESFLFHSLGSWCWKQECLLH
NMCLSTVAKLIGCNINELTLTLSKRNMRVRNDTIVQKLTLPQAIDARDALAKSIYSCLFD
WLVEQINKSLAVGKRRTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKL
EQEEYIQDGIDWTRVDFEDNQNCLSLFEKKPLGLLSLLDEESTFPNGTDLTLANKLKQHL
QSNSCFRGDKGKLFTVVHYAGEVTYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASS
MLIQSEKPVVGPLYKAGGADSQRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSP
GVYEQGLVLQQLRCCGVLEVLCKGPYKRFFIIAILHQFNILPEMYQVGYTKLFFRTGQIG
VLEDTRNRTLHGILRVQSSFRGYQARCLLKELKRGISILQSFVRGEKIRKEFAELRRRHK
AAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTNELGEV
LVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQM
RSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTSNGVGSRLQPMSAG
LSVIGRLAEEFEQRAQVFGDDAKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGR
LRETKLILSKLGSEESSGSMEKVKRKWWGRRNSTRY

www.000webhost.com

Other information
Ka divergence:-0.196837KaKs divergence:-0.377461
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):3462Length 2 (bp):3531Length divergence:0.01
MFE 1 (kcal):-997.79MFE 2 (kcal):-1058.73MFE divergence0.03