Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50370-AT3G19980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcineurin-like metallo-phosphoesterase superfamily protein
Function (paralog2):flower-specific, phytochrome-associated protein phosphatase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.43455544416137
Log2 mRNA fold difference:-0.042049457905204
Log2 TE fold difference:-0.36390677948713
Sequences
Protein sequence

MDLDQWISKVKDGQHLSEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMK
LFQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARHPANITLLRGNHESRQLTQVY
GFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDVRTIDQIRLIERNC
EIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTTEFNHINNLDLVCRAHQLVQEG
LKYMFQDKGLVTVWSAPNYCYRCGNVASILSFNDNMEREVKFFTETEENNQMRGPRTGVP
YFL

MDLDQWISKVKDGQHLSEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMK
LFQTGGHVPDTNYIFMGDFVDRGYNSLEVFTILLLLKARYPANITLLRGNHESRQLTQVY
GFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDVRTIDQIRLIERNC
EIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTTEFNHINKLDLVCRAHQLVQEG
LKYMFQDKGLVTVWSAPNYCYRCGNVASILSFNDNMEREVKFFTETEENNQMRGPRTGVP
YFL

Other information
Ka divergence:0.335294KaKs divergence:-0.0235294
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):912Length 2 (bp):912Length divergence:0
MFE 1 (kcal):-265MFE 2 (kcal):-269.41MFE divergence0.008