Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50400-AT3G20000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Eukaryotic porin family protein
Function (paralog2):translocase of the outer mitochondrial membrane 40

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:5.402278097972
Log2 mRNA fold difference:4.7918657913394
Log2 TE fold difference:0.67783043869293
Sequences
Protein sequence

MEGFSPPINTAQVDAKTKLDEKVDYSNLPCPVLYEELNREATMALKPELFEGFRLDYNKS
LNQKFFLSHSILMGPTEVPNPTPSSEIIKIPTANYDFGAGFIDPKLYLIGRITTDGRLNA
RAKFDLTDNFSVKANALLTDEEDKSQGHLVIDYKGSDYRTQLQLGNNSVYAANYIQHVTP
HLSLGGEAFWLGQQLMSGVGYAARYETDKTVASGQIASTGVAVMNYVHKVSEKLSFATDF
IYNYLSRDVTASVGYDLITRQSRLRGKVDSNGVVAAYLEEQLPIGLRFLLSAEVDHVKKD
YKFGFGVNAF

MADLLPPLTAAQVDAKTKVDEKVDYSNLPSPVPYEELHREALMSLKSDNFEGLRFDFTRA
LNQKFSLSHSVMMGPTEVPAQSPETTIKIPTAHYEFGANYYDPKLLLIGRVMTDGRLNAR
LKADLTDKLVVKANALITNEEHMSQAMFNFDYMGSDYRAQLQLGQSALIGATYIQSVTNH
LSLGGEIFWAGVPRKSGIGYAARYETDKMVASGQVASTGAVVMNYVQKISDKVSLATDFM
YNYFSRDVTASVGYDYMLRQARVRGKIDSNGVASALLEERLSMGLNFLLSAELDHKKKDY
KFGFGLTVG

www.000webhost.com

Other information
Ka divergence:-0.398604KaKs divergence:-0.303055
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):933Length 2 (bp):930Length divergence:-0.002
MFE 1 (kcal):-281.5MFE 2 (kcal):-271MFE divergence-0.019