Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50410-AT3G20010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related
Function (paralog2):SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.94699955268048
Log2 mRNA fold difference:0.11693005689348
Log2 TE fold difference:-0.95598629614458
Sequences
Protein sequence

MDSAIDISSDSDVEIQETRTRPQHPPRIAEGSHRRDLSTLRPHFLSGSSSGANGHTKTGL
TNLDSRNGFESKPLPRAEHHTHIPGNGSIVTSRIPNISVGDYEKFSSQQAFKRTHPPTFS
RPPFPPRPDIGTSNGNASHFRGGAHDDLGMGRVTNGTRILPPSVAHGTSASPSHFNGLSD
PMHRNGIGEERNSENDERLIYQAALQELNQPKSEVDLPAGLLSVPLMKHQKIALAWMFQK
ETNSLHCMGGILADDQGLGKTVSTIALILKQMHEAKLKSKNSGNQEAEALDLDADDESEN
AFEKPESKASNGSGVNGDSGIKKAKGEEASTSTRKFNRKRPAAGTLIVCPASVVRQWARE
LDEKVTDEAKLSVLIYHGGNRTKDPIELAKYDVVMTTYAIVSNEVPKQPLVDDDENDEKN
SEKYGLASGFSINKKRKNVVGTTKKSKKKKGNNNAGDSSDPDSGTLAKVGWFRVVLDEAQ
TIKNHRTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQIKG
PISRNSLQGYKKLQAVLRAIMLRRTKGTLLDGQPIINLPPKTINLSQVDFSVEERSFYVK
LESDSRSQFKAYAAAGTLNQNYANILLMLLRLRQACDHPQLVKRYNSDSVGKVSEEAVKK
LPKEDLVSLLSRLESSPICCVCHDPPEDPVVTLCGHIFCYQCVSDYITGDEDTCPAPRCR
EQLAHDVVFSKSTLRSCVADDLGCSSSEDNSHDKSVFQNGEFSSSKIKAVLDILQSLSNQ
GTSNSTQNGQMASSSQQPNDDDDDDDDDVTIVEKTSLKSTPSNGGPIKTIIFSQWTGMLD
LVELSLIENSIEFRRLDGTMSLIARDRAVKEFSNDPDVKVMIMSLKAGNLGLNMIAACHV
ILLDLWWNPTTEDQAIDRAHRIGQTRPVTVTRITIKNTVEDRILALQEEKRKMVASAFGE
DHGGSSATRLTVDDLKYLFMV

MDSAIEISSGSDSDDEVPPQPVWPQTRTRMDPTWLSRRPLPTVDSHARAEHTNQAPPNGA
SSDTSRPGVSKPFTGNGNTVNSRISSGSGADYVRLSSEQALKRTLPPSFNSPPLPARSGT
NNISNASGSRVGVDYERPLSQQALKRTLPPSFNPPPLPSRSGTNNIRNAGGSRFGADYSH
PAVSAVGNKSTFGDHYSGAHAEIGIQRGVNGVRILPPSLTHGTSASVLHHAGSSDPMHRF
GGGEDRNPDNDERLVYQAALQVLNQPMTESDLPPGTLSVPLMRHQKIALAWMFQKETSSF
NCPGGILADDQGLGKTVSTIALILKQKIVSQLKSESSCKQETEALVLDADDESDNAKHES
GSHVKPELKVSSNSETSVLSACGNDENDSSDMEKAEDEEANSSTRAFQWKRPAAGTLIVC
PASVVRQWARELDEKVSEESKLSVLVYHGSNRTKDPNELAEYDVVVTTYAIVTNEAPNKF
LVDEDENDEKNTDRYGLASGFSNNKKRKVVVGASKKSKRRGRKSTNDTSSEPDCGPLGKV
GWFRIVLDEAQTIKNYRTQMARSCCTLRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYA
VYKSFYSTIKVPISRNSCQGYKKLQAVLRAIMLRRTKGTLLDGKPIINLPPKVVNLSQVD
FSVAERSFYKKLEADSRSQFKAYADAGTLSQNYANILLLLLRLRQACDHPQLVKRYNSDP
VGKVSEAAVRRLPREARSRLINRLESSSAICYECNEPPEKPVVTLCGHIFCYECVLEYIT
GDENTCPVPRCKQQLARDVVFSESSLRNCTSDDSGCSSSHDNGLDRSVFQKRDFCSSKIK
AVLDILQSLSQPDSPNSAQHGQMPSSSRPYDDDDVTIVEPMRLHSSSPSQGAVKTIIFSQ
WTGMLDLVELRILESGIEFRRLDGTMSLAARDRAVKEFSKKPDVKVMLMSLKAGNLGLNM
VAACHVILLDLWWNPTTEDQAIDRAHRIGQTRPVTVTRITIKDTVEDRILKLQEEKRTMV
ASAFGEEHGGSSATRLTVDDLKYLFMV

www.000webhost.com

Other information
Ka divergence:0.244256KaKs divergence:0.220083
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2946Length 2 (bp):3144Length divergence:0.033
MFE 1 (kcal):-844.87MFE 2 (kcal):-953.54MFE divergence0.06