Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50460-AT3G20040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hexokinase-like 1
Function (paralog2):Hexokinase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.0250982422094
Log2 mRNA fold difference:-2.2323874780377
Log2 TE fold difference:-0.70315580560968
Sequences
Protein sequence

MGKVAVAFAAVAVVAACSVAAVMVGRRMKSRRKWRTVVEILKELEDDCDTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVDDLPTGREKGTYYALHLGGTYFRILRVLLGDQRSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIEKEENGSDSQGVRRELAFTFSFPVK
HTSISSGVLIKWTKGFEISEMVGQDIAECLQGALNRRGLDMHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNANDMGFEKMISGMYLGDIVRRVILRMSEDSDIFGPISPVLSEPYVLRTNSVSA
IHEDDTPELQEVARILKDIGVSDVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGR
DGSGGITSGRSRSEIQMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKA
MEDGSSIGSALLVASLQS

MGKVLVMLTAAAAVVACSVATVMVRRRMKGRRKWRRVVGLLKDLEEACETPLGRLRQMVD
AIAVEMQAGLVSEGGSKLKMLLTFVDDLPNGSETGTYYALHLGGSYFRIIKVHLGGQRSS
LEVQDVERHSIPTSLMNSTSEVLFDFLASSLQRFIEKEGNDFSLSQPLKRELAFTFSFPV
KQTSISSGVLIKWTKGFAISEMAGEDIAECLQGALNKRGLDIRVAALVNDTVGALSFGHF
HDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFWSSRLPRTSYDL
ELDAESMNSNDMGFEKMIGGMYLGDIVRRVILRMSQESDIFGPISSILSTPFVLRTNSVS
AMHEDDTSELQEVARILKDLGVSEVPMKVRKLVVKICDVVTRRAARLAAAGIAGILKKVG
RDGSGGGRRSDKQIMRRTVVAVEGGLYLNYRMFREYMDEALRDILGEDVAQHVVVKAMED
GSSIGSALLLASSQSVQTIPSV

www.000webhost.com

Other information
Ka divergence:0.123397KaKs divergence:0.458761
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1497Length 2 (bp):1509Length divergence:0.004
MFE 1 (kcal):-453.6MFE 2 (kcal):-473.9MFE divergence0.022