Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50490-AT3G20060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme 20
Function (paralog2):ubiquitin-conjugating enzyme19

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.9802888432572
Log2 mRNA fold difference:1.2019160067354
Log2 TE fold difference:0.78109970508619
Sequences
Protein sequence

MAAVNGYQGNTPADPPASNGSKQPAAPTKTVDSQSVLKRLQSELMGLMMGGGPGISAFPE
EDNIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICL
DILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNTQAAQLWSNQEEYRKMVEKLYKPPSA

MATVNGYTGNTPAATTPAATGSKQSAPPTKTVDSHSVLKRLQSELMGLMMGADPGISAFP
EEDNIFCWKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNIC
LDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNNQAAQLWSNQEEYRKMVEKLYKPLN
A

Other information
Ka divergence:0.168958KaKs divergence:0.199716
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):543Length 2 (bp):546Length divergence:0.003
MFE 1 (kcal):-164.09MFE 2 (kcal):-157.94MFE divergence-0.019