Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50520-AT1G50560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 705, subfamily A, polypeptide 27
Function (paralog2):cytochrome P450, family 705, subfamily A, polypeptide 25

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.9693212013526
Log2 mRNA fold difference:1.0137809921123
Log2 TE fold difference:-0.0671063608071
Sequences
Protein sequence

MAAITVDFQLCFIFILLGIFSLFCLSAFFFKKPKDPQLQGCGLPPSPPSLPVIGHLHLLL
SVPCLKSFQKLSSKYGPLLHLRAFNIPIVIVSSGSMANEVLRTQDLNFATRQREVSIMEK
SLLFGSFGFVSAPYGDYWRFMKKLLVTNLFGSHSLEQTRLIREKELKTFRTMLFDKAAKK
GTVDVGKEMMKLTNNSICRMIMGRRCSEENSEAEKVEDLVIKSFSLVKKVLIANTVGRLL
KKFGISLFEKEIMEVSQRYDELLEKIIKEHEEDPNKKEDRDMMDVLLEVCADDKAEVKIT
RNQIKALIVELFLGGTDTSAQTIQWIMAELINHPEILKILREEIESVVGTTRFIQETDLS
NLPYLQAVMKEGQRLHPHSPMLVRNATKGCKIGGYYIPQNTTMLINTYAMMIDPDSWENP
DKFQPERFMVSPSKGKDDEREQLALNFIPFGSGRRACPGEKLGYLFTGVAIGTMVQCFDW
IIDGDKVNVEEAGEMTLTMAHPLKCTPVTRVNPLASFESEDPKWLMEEFDMYC

MAAISVDFQLCFIFILLAIFSLFCFSAFFFKKPKDPQLQGCGLPPSPPSLPIIGHLHFLL
SVPCYKSFQKLSSKYGPFLHLRAFNIPIVLVSSGSMANEVLRIQDLNFASRDSGQTPIME
KSLLFGSFGFVSVPYGDYWRFMKKLLVKKLLGSHSLEQTRLLRGKELQTFRAMLFDKAAK
NETVDVGKEMMKLTNNSICRMTMGRSCSEENGEAEQVRGLVTKSLSLTKKFLIASIVGQF
SKLVGISLFGKEIMEVSQRYDELLEKIIKEHEENPNNGEDRDMMDVLLEVCADDNAEFKI
SRNQIKALFVEIFLAGTDTSAQTIQWILAELINHPEILEKLRKEIESVVGVRRLIQETDL
PNLPYLQAVMKEGLRLHPHTPILVRNATEGCKIGGYYIGQNTTMMVNAYAVLRDPDSWEY
PEEFQPERFMTSPLKGKEDEKAQLALNFIPFGSGRRGCLGKNLGYIFMGVAIGTMVQGFD
WRINGDKVNMEETGEMTLTMAHPLKCIPVARINPASFDP

www.000webhost.com

Other information
Ka divergence:0.23164KaKs divergence:0.575706
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1602Length 2 (bp):1560Length divergence:-0.013
MFE 1 (kcal):-462.23MFE 2 (kcal):-474.37MFE divergence0.013