Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50620-AT3G20280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/FYVE/PHD zinc finger superfamily protein
Function (paralog2):RING/FYVE/PHD zinc finger superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.52312912391232
Log2 mRNA fold difference:-0.82524010242857
Log2 TE fold difference:0.30482786138749
Sequences
Protein sequence

MDVAISDDVPVNLESVEEKRDEETVEESPVKKKKPRFDEEVNRVAEIVLVLSALRKIRGG
KPPTELEIDLMVEAKSKLVDMCQEFTPKDIIGVDAIGAVIEDLGFNGKLKDQRLGFRAPK
LTISEKLSLGKRKMEELKKNPVVSTTSTSPAVNNVSMAHQWPNSEMKASASSVNASGSHY
VREASGITQARMERPQFKSDLHTGTSQGPAVPAGNYFGNTTTWSAQPHSSTSTISFGTAS
DSKVPVPSSSRISDPSFRPFMSQTPPGAFPGMKGATYGQTSSPFGNNNHAEIAKLIHKVL
QPRAKQNLLWNPPSREYMSKAMTCQICQGTINEIETVLICDACEKGYHLKCLHAHNIKGV
PKSEWHCSRCVQLYNGKSFPPKYGRVMRSATTAKMSSSTAEVQLPAEKGVGKMDQKVSQE
GMPHLETAKPTKDSAMEQTVEAEDVAMNPIVEKAMSEMVEAEGAAINPIVEAEDGAMNPI
VEKAMSQIVEAEDAAINQAVDANFQTQAPTGNDDAESDDPSEPVSHSETLNPPELEKKEV
MRKDATERSVSADCQDKNSKIIAESSLQEEISASQTENSPTQPPSQSDTDHSQQQKTTPN
VEEEKSASQAENSPTQPPSQSNTDHFPTA

MDIATSNAPMNLESVAMVDGNGAEPVSPPAKKPRFDEEMNRVAEIVLVLSALGRMRGGET
PTALELELMFEARSKLAGMCLEFDPKDIIRKDDVKSVIEDLGFNGKLKDQRLGFRAPTVT
ISEKLSLGKRKMEEAEKYPTTSTVSTGYTLSQPNGSLASPGGLANKASVAHQWPSSEVAT
ANTSGSHFKLDRPQMVLNGASQGTPVSSANYYAEPWSAQLPSTISFSTAPDKKVPIQSSV
RTADPSFRPFRHGTFTGTNQPMHYSQTSSFGGNHTEIAKIIHKFLQPRVKQYPLWNPPSR
EYMSRAMACQICEVTINEMDTLLICDACEKAYHLKCLQGNNMKGVPKSEWHCSRCVQAFN
GKPFPPTYGRATRAVATTTAKMPFRAAGVLSSSAKKIGPMDIKANQQKPIVSTFSRLQNT
GLVSGAATTSQFESASVNAKTTASAAKTTNIGSQGSKENVACGANSPAPVSLTETPNRTG
IASTISVINNGLISKPLTPVGTMSSTSPLPVVNQLPVNATSNASPSTPITASLVAQAPTV
TQNGDGSSTASGTADHSILNADITTQVHTLTVTSSSNSQQAVSHSEVAKATEDAAPLENV
SECEKPSESTSHPDSLNDKTISENVQESSKDAKVDSEACQNHPTASPATVVPDQDSTITA
APSVTQEDSAFNTEKTPPQPLSVSSNYDSQTEKETPNVQDSVHNVPGDSEKGKGLNGLDD
RHQEQPSEPEFYKSDSVKEENAA

Other information
Ka divergence:-0.0721231KaKs divergence:-0.269628
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1890Length 2 (bp):2232Length divergence:0.083
MFE 1 (kcal):-545.6MFE 2 (kcal):-659.48MFE divergence0.094