Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50630-AT3G20300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3537)
Function (paralog2):Protein of unknown function (DUF3537)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.8039492518314
Log2 mRNA fold difference:-1.1564128366081
Log2 TE fold difference:-0.68824662169763
Sequences
Protein sequence

MADIDIAVGKEPLINHENNNNTNKIFNRCVSHQQDELHSFRKYLRWMCVDHSSPWTAILS
WTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSVVQLSLSSVATVSFLCLTRFVSKYGL
RRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFVIPCFSAMSAYKIWWYASGGSRIPFL
GNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAKLFQIDSDVGSIL
SEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSSLLITTKAYTEVNIYRAGELALCSMT
LVTALLILLRSASKITHKAQAVTCLAAKWHVCATLESFDQTVESFDQTVETPTLVARNNN
DNNNVHDVVTLTESDSDEYGDEEDDLDNNDIIPVYAFSTMSFQKRQALVSYFENNSAGIT
VYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS

MADIDIGTAATTGGNEGRGGTRERLINRENKFTRSVSHAQDELHSFRKYLRWMCVDQSSP
WTAVLSWSMFVVFTLVVPATSHFMLACSDCDSHHSRPYDSVVQLSLSSFAALSFLCLSRF
VSKYGLRRFLFFDKLWDESETVRLGYTNQLNRSLKILSYFVSPCFLAMSSYKIWWYASGA
SQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDS
DVGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYAELNIYRAGEL
ALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGETPRLVDRASG
HGYYPTDDDNGESDSEDYGDEEDDFDNNNLIPAYAYSTISFQKRQALVNYFENNRSGITV
FGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS

www.000webhost.com

Other information
Ka divergence:-0.405073KaKs divergence:-0.184358
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1362Length 2 (bp):1359Length divergence:-0.001
MFE 1 (kcal):-362.71MFE 2 (kcal):-402.5MFE divergence0.052