Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50640-AT3G20310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ethylene responsive element binding factor 3
Function (paralog2):ethylene response factor 7

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.35291581201018
Log2 mRNA fold difference:-0.52272666136747
Log2 TE fold difference:0.16925869175829
Sequences
Protein sequence

MRRGRGSSAVAGPTVVAAINGSVKEIRFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDSA
EEAARAYDSAARNLRGPKAKTNFPIDSSSPPPPNLRFNQIRNQNQNQVDPFMDHRLFTDH
QQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVPEDCHSDCDSSSSVI
DDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADDLHCTDLRL

MRKGRGSSVVGPALPVTAGGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTFDSAV
DAARAYDTAARNLRGPKAKTNFPIDCSPSSPLQPLTYLHNQNLCSPPVIQNQIDPFMDHR
LYGGGNFQEQQQQQIISRPASSSMSSTVKSCSGPRPMEAAAASSSVAKPLHAIKRYPRTP
PVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKTPFQFDLNFPPLDGVDLFAGGIDDLHCT
DLRL

Other information
Ka divergence:-0.0539337KaKs divergence:-0.181726
GC content 1 (%):50GC content 2 (%):53GC content divergence:0.029
Length 1 (bp):678Length 2 (bp):735Length divergence:0.04
MFE 1 (kcal):-216.2MFE 2 (kcal):-263.57MFE divergence0.099