Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50660-AT3G20350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.79500229785021
Log2 mRNA fold difference:-0.92113651151605
Log2 TE fold difference:0.2536420318293
Sequences
Protein sequence

MKVTGKPYSTATLPAFESDKNLFSHGPDLRAIQRATTVTKRRARNPSLTRQRRSGPSGGR
RSRPETPLLKWKVEDRNKERSGVVEDDDYEDDNHQVARSETTRRKDRRKIARPVSVRKLA
AGLWRLQVPDASSSGGERKGKEGLGFQGNGGYMGVPYLYHHSDKPSGGQSNKIRQNPSTI
ATTKNGFLCKLEPSMPFPHSAMEGATKWDPVCLDTMEEVHQIYSNMKRIDQQVNAVSLVS
SLEAELEEAHARIEDLESEKRSHKKKLEQFLRKVSEERAAWRSREHEKVRAIIDDMKTDM
NREKKTRQRLEIVNHKLVNELADSKLAVKRYMQDYEKERKARELIEEVCDELAKEIGEDK
AEIEALKRESMSLREEVDDERRMLQMAEVWREERVQMKLIDAKVALEERYSQMNKLVGDL
ESFLRSRDIVTDVKEVREAELLRETAASVNIQEIKEFTYVPANPDDIYAVFEEMNLGEAH
DREMEKSVAYSPISHDSKVHTVSLDANMMNKKGRHSDAYTHQNGDIEEDDSGWETVSHLE
EQGSSYSPDGSIPSVNNKNHNHRHSNASSGGTESLGKVWDDTMTPTTEISEVCSIPRRSS
KKVSSIAKLWRSTGASNGDRDSNYKVISMEGMNGGRVSNGRKSSAGMVSPDRVSSKGGFS
PMMDLVGQWNSSPESANHPHVNRGGMKGCIEWPRGAQKSSLKSKLIEARIESQKVQLKHV
LKQRI

MKFTGKSNLTATLPATVPNIRDIHRRRARKPSFTRQRRSGVSVRRLSRPETPQLKSKVED
QNIERCGGVEDGDNEDDDCNKMRCQERSRSVRPDTVRKLAAGVWRLRVPDAVSSGGDKRS
KDRLRFQETAGPAGNLGPLFYYHHHDDKHSGFQSNNSRNKHSRFLCKHEPSVPFPHCAME
GATKWDPICLDTRDDVHQIYTNVKWNNQQVNDVSLASSIELKLQEARACIKDLESEKRSQ
KKKLEQFLKKVSEERAAWRSREHEKVRAIIDDMKADMNQEKKTRQRLEIVNSKLVNELAD
SKLAVKRYMHDYQQERKARELIEEVCDELAKEIEEDKAEIEALKSESMNLREEVDDERRM
LQMAEVWREERVQMKLIDAKVTLEEKYSQMNKLVGDMEAFLSSRNTTGVKEVRVAELLRE
TAASVDNIQEIKEFTYEPAKPDDILMLFEQMNMGENQDRESEQYVAYSPVSHASKAHTVS
PDVNLINKGRHSNAFTDQNGEFEEDDSGWETVSHSEEHGSSYSPDESIPNISNTHHRNSN
VSMNGTEYEKTLLREIKEVCSVPRRQSKKLPSMAKLWSSLEGMNGRVSNARKSTVEMVSP
ETGSNKGGFNTLDLVGQWSSSPDSANANLNRGGRKGCIEWPRGAHKNSLKTKLIEAQIES
QKVQLKHVLEHKI

Other information
Ka divergence:0.462537KaKs divergence:0.602809
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2178Length 2 (bp):2022Length divergence:-0.037
MFE 1 (kcal):-646.16MFE 2 (kcal):-579.18MFE divergence-0.055