Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50700-AT3G20410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calcium-dependent protein kinase 33
Function (paralog2):calmodulin-domain protein kinase 9

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1376343733686
Log2 mRNA fold difference:1.7761757499663
Log2 TE fold difference:0.23801465406127
Sequences
Protein sequence

MGNCLAKKYGLVMKPQQNGERSVEIENRRRSTHQDPSKISTGTNQPPPWRNPAKHSGAAA
ILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDKEDMRR
EIQIMQHLSGQPNIVEFKGAYEDEKAVNLVMELCAGGELFDRILAKGHYSERAAASVCRQ
IVNVVNICHFMGVMHRDLKPENFLLSSKDEKALIKATDFGLSVFIEEGRVYKDIVGSAYY
VAPEVLKRRYGKEIDIWSAGIILYILLSGVPPFWAETEKGIFDAILEGEIDFESQPWPSI
SNSAKDLVRRMLTQDPKRRISAAEVLKHPWLREGGEASDKPIDSAVLSRMKQFRAMNKLK
KLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLAKLGSRLTEAEVKQLMD
AADVDGNGSIDYIEFITATMHRHRLESNENVYKAFQHFDKDGSGYITTDELEAALKEYGM
GDDATIKEILSDVDADNDGRINYDEFCAMMRSGNPQQPRLF

MGNCFAKNHGLMKPQQNGNTTRSVEVGVTNQDPPSYTPQARTTQQPEKPGSVNSQPPPWR
AAAAAPGLSPKTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACK
SISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAYEDEKAVNLVMELCAGGELFDR
IIAKGHYTERAAASVCRQIVNVVKICHFMGVLHRDLKPENFLLSSKDEKALIKATDFGLS
VFIEEGKVYRDIVGSAYYVAPEVLRRRYGKEVDIWSAGIILYILLSGVPPFWAETEKGIF
DAILEGHIDFESQPWPSISSSAKDLVRRMLTADPKRRISAADVLQHPWLREGGEASDKPI
DSAVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEG
LAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDS
SGYITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRL
F

www.000webhost.com

Other information
Ka divergence:-0.236802KaKs divergence:0.137081
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):1566Length 2 (bp):1626Length divergence:0.019
MFE 1 (kcal):-418.37MFE 2 (kcal):-473.67MFE divergence0.062