Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50740-AT3G20510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transmembrane proteins 14C
Function (paralog2):Transmembrane proteins 14C

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.43597809153391
Log2 mRNA fold difference:0.35396142954399
Log2 TE fold difference:0.072655047024118
Sequences
Protein sequence

MHDFCFTIPYGILLIVGGFIGYLKKGSIASLAGGAGTGLLVVLAGFISLKAFEKKKTSLL
ATLLETVIAAALTFVMGQRFLQTQKIMPAALVAGISALMTCFYVYKIATGGNHIPPKAE

MHDFCFTIPYGMLLIGGGFIGYMKKGSITSFAGGAGTGLLLILAGYISLKAFEKKKNSTI
AMVLQTVIAAALTLVMGQRYLLTGKIMPAGLVAGISALMTCFYVYKIATGGNKFPAKAE

Other information
Ka divergence:-0.409656KaKs divergence:-0.651007
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):360Length 2 (bp):360Length divergence:0
MFE 1 (kcal):-113.2MFE 2 (kcal):-102.72MFE divergence-0.049