Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50840-AT3G20540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):polymerase gamma 2
Function (paralog2):polymerase gamma 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.69245161762316
Log2 mRNA fold difference:-0.16638755916918
Log2 TE fold difference:-0.48416064565378
Sequences
Protein sequence

MAMGVSLTSHNNPLLRHLSPSSSWVSRSSSRLSSSPLPSFLFPCRRTLLQRKLASTDGNV
GYCTTTVCQGFQHSVHQRSSSVVFNGEWELRSESNKVRMVPKIIKVGNQTEVAETHQVPG
TVSAWREEANKLRERNGQIARNLDDNGYFNGSVPIISSAPSYETSQKIDYEFKPRGTTRS
TTATLNKELIGITQSEPVVSLPRKGLDVGDNMDVNPKGEGIQRPLISDKSSGTANGNKNT
VAISKVERSTEPSNVRENLGKIYDKVLIVDNVQAAKDTVAKLVNQFRNHVHSCDTEVSGI
EVKEETPVDHGELICFSIYCGPEADFGNGKSCIWVDVLGENGREVLAEFKPYFEDSFIRK
VWHNYSFDSHIIRNHGIEISGFHADTMHMARLWDSARRIKGGYSLEALTSDPKVLGGTQT
KEEAEFLGKISMKTIFGKRKLKKDGSEGKIVVIPPVEELQREDREAWISYSALDAISTLK
LYESMTKKLQLMDWHLDGKPVLGRTMLDFYHEFWRPFGELLVKMEAEGILVDREYLAEIE
KVAKAEQQVAGSRFRNWASKYCPDAKYMNIGSDTQLRQLFFGGISNSHDEVLPVEKLFKV
PNIDKVIEEGKKTPTKFRNIKLHRISDSPLSTENFTASGWPSVGGDVLKELAGKVSAEYD
FMDDVSDISLEEVVEDDDVETSETQKSKTDDETDTSAYGTAYVAFGGGERGKEACHAIAS
LCEVCSIDSLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALEKDR
YKIRKAFVASPGNTLVVADYGQLELRILAHLTGCKSMMEAFKAGGDFHSRTAMNMYPHVR
EAVENGQVILEWHPEPGEDKPPVPLLKDAFGSERRKAKMLNFSIAYGKTAVGLSRDWKVS
TKEAQETVDLWYNDRQEVRKWQEMRKKEAIEDGYVLTLLGRSRRFPASKSRAQRNHIQRA
AINTPVQGSAADVAMCAMLEISINQQLKKLGWRLLLQIHDEVILEGPIESAEIAKDIVVD
CMSKPFNGRNILSVDLSVDAKCAQNWYAAK

MGVSLRHLSPSSFWVSRRPRVSSSILSFLVPRRRILCTRSRLKMCVCSIALFRKKVAIIK
GNAGYSTATDCGGSHGFHHSGHQRSSSVEFSGEWKLNLGSKTARMVPPTVKQAGAVSAWR
EEVNNKLRGRNREYANNQDDAFGNGSYILKGFVPKIDDVHSYGNGQNFDYNLKPGTDITT
LGRELNGFMQTNSIRGSVVALPSKDIEVGETTDVTLKPLNSDTTLDNASYKKTATISKVE
KCTNLSQVRANLKKIYNRVRVVDNVSSAKETVALLMNQYRNLVHACDTEVSRIDVKTETP
VDHGEMICFSIYCGSEADFGDGKSCIWVDVLGENGRDILAEFKPFFEDSSIKKVWHNYSF
DNHIIRNYGIKLSGFHGDTMHMARLWDSSRRISGGYSLEALTSDPKVLGGTETKEEAELF
GKISMKKIFGKGKLKKDGSEGKLVIIPPVKELQMEDREAWISYSALDSISTLKLYESMKK
QLQAKKWFLDGKLISKKNMFDFYQEYWQPFGELLAKMESEGMLVDRDYLAQIEIVAKAEQ
EIAVSRFRNWASKHCPDAKHMNVGSDTQLRQLFFGGISNSCNDEDLPYEKLFKVPNVDKV
IEEGKKRATKFRNIKLHRISDRPLPTEKFTASGWPSVSGDTLKALAGKVSAEYDYMEGVL
DTCLEENIGDDDCISLPDEVVETQHVNTSVESDTSAYGTAFDAFGGGESGKEACHAIAAL
CEVCSIDSLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALEKDRY
KIRQAFIASPGNSLIVADYGQLELRILAHLASCESMKEAFIAGGDFHSRTAMNMYPHIRE
AVENGEVLLEWHPQPGQEKPPVPLLKDAFASERRKAKMLNFSIAYGKTAIGLSRDWKVSR
EEAQDTVNLWYNDRQEVRKWQELRKKEAIQKGYVLTLLGRARKFPEYRSRAQKNHIERAA
INTPVQGSAADVAMCAMLEISNNQRLKELGWKLLLQVHDEVILEGPSESAENAKDIVVNC
MSEPFNGKNILSVDLSVDAKCAQNWYAGK

Other information
Ka divergence:-0.0268216KaKs divergence:-0.141271
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):3153Length 2 (bp):3150Length divergence:0
MFE 1 (kcal):-967.41MFE 2 (kcal):-938.02MFE divergence-0.015