Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G50950-AT3G20560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Thioredoxin protein with domain of unknown function (DUF1692)
Function (paralog2):PDI-like 5-3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.46486001843
Log2 mRNA fold difference:2.1819844885613
Log2 TE fold difference:-0.70808774987787
Sequences
Protein sequence

MVSTSKIKSVDFYRKIPRDLTEASLSGAGLSIVAALAMLFLFGMELSSYLAINTSTSVIV
DKSSDGDFLNIDFNISFPALSCEFASVDVSDVFGTHRLNISKTIRKVPIDPHLRATAEEF
HSTSDLHLINHGDEDHGDNSTYADIPLTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPS
WVKASQITRERYNPGTDDRVLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGN
HEHESYYGDRDTDSLVKMVEELLKPIKKEDHKLALDGKSDNAASTFKKAPVSGGCRIEGY
VRAKKVPGELVISAHSGAHSFDASQMNMSHIVTHLTFGTMVSERLWTDMKRLLPYLGQSY
DRLNGKSFINERQLDANVTIEHYLQIIKTEVISRRSGQEHSLIEEYEYTAHSSVARSYHY
PEAKFHFELSPMQVLISENPKSFSHFITNVCAIIGGVFTVAGILDSIFQNTVRMVKKIEL
GKNI

MVSSTKLKSVDFYRKIPRDLTEASLSGAGLSIVAALFMMFLFGMELSSYLEVNTTTAVIV
DKSSDGDFLRIDFNISFPALSCEFASVDVSDVLGTNRLNITKTVRKFPIDPHLRSTGAEF
HSGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSW
EKAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHH
EHESYYGDRDTDSIVKMVEGLVAPIHPETHKVALDGKSNDTVKHLKKGPVTGGCRVEGYV
RVKKVPGNLVISAHSGAHSFDSSQMNMSHVVSHFSFGRMISPRLLTDMKRLLPYLGLSHD
RLDGKAFINQHEFGANVTIEHYLQTVKTEVITRRSGQEHSLIEEYEYTAHSSVAQTYYLP
VAKFHFELSPMQILITENPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTVRLVKKVELG
KNI

Other information
Ka divergence:-0.315312KaKs divergence:-0.205457
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1455Length 2 (bp):1452Length divergence:-0.001
MFE 1 (kcal):-391.89MFE 2 (kcal):-402.32MFE divergence0.013