Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51060-AT3G20670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):histone H2A 10
Function (paralog2):histone H2A 13

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0878706089874
Log2 mRNA fold difference:-1.8123363798994
Log2 TE fold difference:0.83640320661415
Sequences
Protein sequence

MAGRGKTLGSGSAKKATTRSSKAGLQFPVGRIARFLKKGKYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPK
KTGASKPSAEDD

MAGRGKTLGSGVAKKSTSRSSKAGLQFPVGRIARFLKNGKYATRVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHSLLLPK
KAGASKPSADED

www.000webhost.com

Other information
Ka divergence:0.510102KaKs divergence:0.676555
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):399Length 2 (bp):399Length divergence:0
MFE 1 (kcal):-134.1MFE 2 (kcal):-136.24MFE divergence0.008