Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51170-AT3G20830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.7674706921259
Log2 mRNA fold difference:-0.064118437325101
Log2 TE fold difference:-0.58209270873528
Sequences
Protein sequence

METRPSSSSSLSPATNLNLDRLKVLKLLGKGATGTVFLVHDSVSDSSVSSPFALKLVDKS
SASSLRRARWEIQILRRLSDDTNPNPFLPKLLASSESSEFIAWALPYCSGGDLNVLRQRQ
NDGVFSSSVIKFYLAEIVCALDHLHTMGIAYRDLKPENILLQESGHVTLTDFDLSCSLNK
PTRPEFYHLSDPEPDPNPESNLSHNKKSLRIFRQKKKKTKSARVNPITRRRLSFSGGERS
NSFVGTDEYISPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGRNKKETFRNVLVKEP
EFAGKPSDLTDLIRRLLVKDPTKRFGFWRGAAEIKEHAFFKGVRWELLTEVLRPPFIPLR
DDGDLTGKVTEESGFGIKEYFEKLKTPPLPLPHECSENNPFVDF

MEPSPSSPPSSPPEILDLDSIKALKILGKGATGTVFLAHDVVSTSSSSSPFAVKLVPKSS
ASSLRRARWEIEVLRRLSVDSNQNPFLPRLLASFESPEYFAWAVPYCSGGDLNVLLHRQN
DGVFSSSVIRFYVAEIVCALEHLHTMGIAYRDLKPENILIQQSGHVTLTDFDLSRSLKKP
LRPHFYQPDPELIIDRKKSRSFSRLISPTAEKNKTGLKKTRSARVNPINRRKTSFSSGER
SNSFVGTDEYVSPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGKSKKETFRNVLMKE
PEFAGKPNDLTDLIRRLLVKDPNRRLGCHRGAAEIKELAFFAGVRWDLLTEVLRPPFIPL
RDDGELTVGGFDIREHFEKLRTTPSSAPPSPLRSPPHVCRKNDPFIEF

Other information
Ka divergence:-0.0724478KaKs divergence:0.468294
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):1215Length 2 (bp):1227Length divergence:0.005
MFE 1 (kcal):-374.6MFE 2 (kcal):-417.08MFE divergence0.054