Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51190-AT3G20840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.52149554895056
Log2 mRNA fold difference:0.28115070961803
Log2 TE fold difference:0.24570142516385
Sequences
Protein sequence

MNSNNWLAFPLSPTHSSLPPHIHSSQNSHFNLGLVNDNIDNPFQNQGWNMINPHGGGGEG
GEVPKVADFLGVSKSGDHHTDHNLVPYNDIHQTNASDYYFQTNSLLPTVVTCASNAPNNY
ELQESAHNLQSLTLSMGSTGAAAAEVATVKASPAETSADNSSSTTNTSGGAIVEATPRRT
LETFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQVYLGGYDKEEKAARAYD
LAALKYWGPSTTTNFPITNYEKEVEEMKNMTRQEFVASIRRKSSGFSRGASMYRGVTRHH
QHGRWQARIGRVAGNKDLYLGTFSTEEEAAEAYDIAAIKFRGLNAVTNFEINRYDVKAIL
ESNTLPIGGGAAKRLKEAQALESSRKREEMIALGSNFHQYGAASGSSSVASSSRLQLQPY
PLSIQQPFEHLHHHQPLLTLQNNNDISQYHDSFSYIQTQLHLHQQQTNNYLQSSSHTSQL
YNAYLQSNPGLLHGFVSDNNNTSGFLGNNGIGIGSSSTVGSSAEEEFPAVKVDYDMPPSG
GATGYGGWNSGESAQGSNPGGVFTMWNE

MNSNNWLGFPLSPNNSSLPPHEYNLGLVSDHMDNPFQTQEWNMINPHGGGGDEGGEVPKV
ADFLGVSKPDENQSNHLVAYNDSDYYFHTNSLMPSVQSNDVVVAACDSNTPNNSSYHELQ
ESAHNLQSLTLSMGTTAGNNVVDKASPSETTGDNASGGALAVVETATPRRALDTFGQRTS
IYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQVYLGGYDKEDKAARSYDLAALKYWGP
STTTNFPITNYEKEVEEMKHMTRQEFVAAIRRKSSGFSRGASMYRGVTRHHQHGRWQARI
GRVAGNKDLYLGTFSTEEEAAEAYDIAAIKFRGLNAVTNFEINRYDVKAILESSTLPIGG
GAAKRLKEAQALESSRKREAEMIALGSSFQYGGGSSTGSGSTSSRLQLQPYPLSIQQPLE
PFLSLQNNDISHYNNNNAHDSSSFNHHSYIQTQLHLHQQTNNYLQQQSSQNSQQLYNAYL
HSNPALLHGLVSTSIVDNNNNNGGSSGSYNTAAFLGNHGIGIGSSSTVGSTEEFPTVKTD
YDMPSSDGTGGYSGWTSESVQGSNPGGVFTMWNE

www.000webhost.com

Other information
Ka divergence:0.0618871KaKs divergence:0.288381
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1707Length 2 (bp):1725Length divergence:0.005
MFE 1 (kcal):-503.39MFE 2 (kcal):-535.35MFE divergence0.031