Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51390-AT3G20970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NFU domain protein 5
Function (paralog2):NFU domain protein 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.2607569019283
Log2 mRNA fold difference:0.16818454760116
Log2 TE fold difference:1.027186220189
Sequences
Protein sequence

MKGLTRLLNSLSRHTASVTCSPSSSSLLISRRSLFISAATHFPVNFSESITTNASRNCSR
SSSFPFNWIEQRRTMFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIF
AIDGVVRVFYGSDFVTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAKDTAI
HEDDSETVAMIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTL
KSGIENMLMHYVSEVKGVEQEFDGEEEGTSSGPME

MKGIARLVTSLSRIGGRKVVSGTSTVTSSSSSSLLLSRRSLFISATNLLNSRTKDSALPS
LNSSLLAQKWNFLGGQRRTMFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPL
AKSIYSIDGVVRVFFGSDFVTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAA
KDTAISEDDSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPS
SSVTLKSGIENMLMHYVSEVKGVEQEFDGEDEEGTLSGEMRVE

Other information
Ka divergence:-0.33416KaKs divergence:-0.352535
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):828Length 2 (bp):852Length divergence:0.014
MFE 1 (kcal):-234.17MFE 2 (kcal):-249.51MFE divergence0.032