Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G51400-AT3G21055
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Photosystem II 5 kD protein
Function (paralog2):photosystem II subunit T

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4212645124259
Log2 mRNA fold difference:1.5663979266184
Log2 TE fold difference:-0.15483218337344
Sequences
Protein sequence

MASMTMTSSFLPTVSNLPANISSNSRRSLTVVKASGSENTTSLENKKQEQSMKMRRDLVF
TAAAAAVCSLAKVAMADDEPKRGTEAAKKKYAPVCVTMPTAKICRN

MASMTMTATFFPAVAKVPSATGGRRLSVVRASTSDNTPSLEVKEQSSTTMRRDLMFTAAA
AAVCSLAKVAMAEEEEPKRGTEAAKKKYAQVCVTMPTAKICRY

Other information
Ka divergence:0.418409KaKs divergence:0.999934
GC content 1 (%):50GC content 2 (%):56GC content divergence:0.057
Length 1 (bp):321Length 2 (bp):312Length divergence:-0.014
MFE 1 (kcal):-94.4MFE 2 (kcal):-114.84MFE divergence0.098